Search Results

Title Detail Species Tag Identifier Product type Price Add to cart
RNF12   ring finger protein, LIM domain interacting
QRRARS*RS*PEHRR [residues 207 - 219 of human]
SA310 Antibodies
£150.00
RAB35 GST-RAB35 [DU 26867] SA314 Antibodies
£150.00
RUBCNL   rubicon like autophagy enhancer
GST-KIAA0226L (1 - 440) [DU 26405]
SA297 Antibodies
£150.00
FAM83H   Family with sequence similarity 83 member H
GST-FAM83H [DU 28403]
SA273 Antibodies
£150.00
KCC3A potassium chloride cotransporter 3
IEDLSQNS*ITGEHSQ [residues 89 - 103 of human]
S042D Antibodies
£150.00
KCC3A potassium chloride cotransporter 3
CYQEKVHMT*WTKDKYM [residues 1041 - 1055 of human]
S961C Antibodies
£150.00
KCC3A potassium chloride cotransporter 3
SAYTYERT*LMMEQRSRR [residues 984 - 998 of human ]
S959C Antibodies
£150.00
RAB35 CRILVGNKNDDPERKVVETEDAYKFAGQMGI [residues 114 - 144 of human] SA101 Antibodies
£150.00
RAB12 CKSTVGVDFKIKTVELRGKKIRLQIWDTAGQER [residues 71 - 103 of human] SA100 Antibodies
£150.00
RAB5A CKKLPKNEPQNPGANSARGRGVDLTEPTQPTRN (residues 179 - 210 of human) SA099 Antibodies
£150.00
RAB3A CDMEDERVVSSERGRQLADHLGFEFFEASAK [residues 137 - 167 of human] SA098 Antibodies
£150.00
USP26 GST-USP26 (554 - 753 mouse) [DU 53038] SA085 Antibodies
£150.00
Rab35 AGQERFRT*ITSTYYR [residues 65 - 79 of human] SA083 Antibodies
£150.00
Rab3A AGQERYRT*ITTAYYR [residues 79 - 93 of human] SA082 Antibodies
£150.00
RAB8A RAB8A, member RAS oncogene family
CKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFR [residues 172 - 203 of human]
S969D Antibodies
£150.00
Spt5 His-Spt5 (792 - 1013 yeast) [DU 47650] SA016 Antibodies
£150.00
RAB39B GST-RAB39B [DU 43849] S935D Antibodies
£150.00
RAB7L   His-SUMO-RAB7L (1 - 203) [DU 50291] S984D Antibodies
£150.00
Filamin Filamin
CSKTRGGETKREVRVEEST [residues 2160 - 2177 of human]
R1899 Antibodies
£150.00
IRS Insulin Receptor Substrate 1
RTESITATS*PASMVGGKK [residues 299 - 315 of mouse]
S487A Antibodies
£150.00
p70 S6 Kinase 2   p70 ribosomal protein S6 kinase 2 (mouse)
RPPSGTKKSKKGRGRSGR [residues 468 - 485 of mouse]
S470A Antibodies
£150.00
p70 S6 Kinase 2   p70 ribosomal protein S6 kinase 2
RPPSGTKKSKRGRGRPGR [residues 465 - 482 of human]
S469A Antibodies
£150.00
CDKL5 (human) GST-CDKL5 (350 - 650) [DU 50406] S957D Antibodies
£150.00
DIA2 DIA2 (199 - 732 yeast) [DU 49475] S960D Antibodies
£150.00
RAB10 RAB10, member RAS oncogene family
CTPVKEPNSENVDISSGGGVTGWKSK [residues 131 - 155 of human]
S945D Antibodies
£150.00
RAB5A RAB5A, member RAS oncogene family
AGQERYHS*LAPMYYR [residues 77 - 91 of human]
S942D Antibodies
£150.00
CRMP4 phospho Thr 509 FDLTTT*PKGGT [residues 504 - 514 of human] S579B Antibodies
£150.00
CRMP2 phospho Thr 514 CEVSVTPKTVT*PAS [residues 505 - 517 of human] S375B Antibodies
£150.00
CRMP1 phospho Thr 509 YEVPAT*PKYAT [residues 504 - 514 of human] S578B Antibodies
£150.00
CRMP2 phospho Thr 509 + Thr 514 CEVSVT*PKTVT*PAS [residues 505 - 517 of human] S441C Antibodies
£150.00
CRMP4 phospho Ser 522 GSARGS*PTRPNP [residues 517 - 528 of human] S202C Antibodies
£150.00
CRMP2 phospho Ser 522 CASSAKTS*PAKQQA [residues 516 - 528 of human] S761B Antibodies
£150.00
RAB7L   IAGQERFT*SMTRLYYR [residues 64 - 9 of human] S877D Antibodies
£150.00
RAB12 AGQERFNS*ITSAYYR [residues 99 - 113] S876D Antibodies
£150.00
RAB7A AGQERFQS*LGVAFYR [residues 65 - 79 of human] S875D Antibodies
£150.00
RAB8A RAB8A, member RAS oncogene family
AGQERFRT*ITTAYYR [residues 65 - 79 of human]
S874D Antibodies
£150.00
RAB10 AGQERFHT*ITTSYYR [residues 66 - 80 of human] S873D Antibodies
£150.00
SGK3 GST-SGK3 (1 - 130) DU 2034 S848D Antibodies
£150.00
USP34 GST-USP34 (1-200 mouse) S702D Antibodies
£150.00
Rab7A GST-RAB7A (mouse) [DU 46688] S824D Antibodies
£150.00
PARKIN (PARK2 tv3)   parkinson protein 2, E3 ubiquitin protein ligase (parkin)
GST-PARKIN [DU 8102]
S830D Antibodies
£150.00
RAB1A CQEIDRYAS*ENVNKLR [residues 107 - 120 of human] S817D Antibodies
£150.00
SV2A   synaptic vesicle glycoprotein 2A
RRGGASSDAT*EGHDEDDRR [residues 77 - 91 of human]
S815D Antibodies
£150.00
CYLD (Database only)   cylindromatosis (turban tumor syndrome)
His-CYLD [DU 1834]
S413D Antibodies
£150.00
MMGT   Membrane Magnesium Transporter 1
GST-MMGT (70 - 131) [DU 38865]
S342D Antibodies
£150.00
NDRG2 (Database Only) N-myc Downstream Regulated Gene
LSRSRTAS*LTSA [residues 325 - 337 of human]
S973A Antibodies
£150.00
NDRG2 (Database Only) N-myc Downstream Regulated Gene
LSRSRT*ASLTSA [residues 325 - 337 of human]
S972A Antibodies
£150.00
Raptor Regulatory Associated Protein Of MTOR
MESEMLQSPLLGLGEEDEAD [residues 1 - 20 of human]
S260D Antibodies
£150.00
MCM7 His-MCM7 (1 - 222 C. elegans) DU49538 S797D Antibodies
£150.00
EVL18   His-EVL18 (1 - 222 C. elegans) DU49540 S782D Antibodies
£150.00