Search Results

Title Detail Species Tag Identifier Product type Price Add to cart
MINDY2   MINDY lysine 48 deubiquitinase 2
GST-MINDY2 (498 - 621) [DU 59344]
SA593 Antibodies
£150.00
MINDY2   MINDY lysine 48 deubiquitinase 2
GST-MINDY2 (1 - 240) [DU 59328]
SA592 Antibodies
£150.00
MINDY4   MINDY lysine 48 deubiquitinase 4
GST-MINDY4 (490 - 610) [DU 59306]
SA582 Antibodies
£150.00
MINDY4   MINDY lysine 48 deubiquitinase 4
GST-MINDY4 (1 - 200)) [DU 59314]
SA581 Antibodies
£150.00
ZUFSP GST-ZUFSP (1 - 578) [DU 59309] SA558 Antibodies
£150.00
CK1 alpha   Casein Kinase 1 Alpha
GST-CK1 alpha (1 - 337) [DU 329]
SA527 Antibodies
£150.00
CDKL5 cyclin dependent kinase like 5
GNNANYTEY*VATRWYR
SA547 Antibodies
£150.00
CDKL5   GNNANYT*EY*VATRWYR SA546 Antibodies
£150.00
CEP131 CKKPPVSRRPGS*AATTKP [residues 27 - 41 of human] SA373 Antibodies
£150.00
CEP131   GST-CEP131 (901 - 1083) [DU 58252] SA444 Antibodies
£150.00
CEP131   GST-CEP131 (601 - 900)[DU 58251] SA443 Antibodies
£150.00
MAP1S   microtubule associated protein 1S
GST-MAP1S (751 - 1059) [DU 58249]
SA442 Antibodies
£150.00
MAP1S   microtubule associated protein 1S
GST-MAP1S (1 - 250) [DU 58247]
SA441 Antibodies
£150.00
KLF2 RPPPPPDT*PPLS*PDGPLR [ residues 164 - 181 of mouse] SA386 Antibodies
£150.00
MAP1S   microtubule associated protein 1S
KKDRNRPLS*ARSEPAD [ residues 806 - 819 of mouse]
SA385 Antibodies
£150.00
CEP131   centrosomal protein 131
KKPPMSQRPGS*ASATRS [residues 27 - 41 of mouse]
SA384 Antibodies
£150.00
UHRF1   ubiquitin like with PHD and ring finger domains 1
MBP-UHRF1 (1 - 300) [DU 53946]
SA390 Antibodies
£150.00
Syntaxin 12   Syntaxin 12 phospho Ser 139
C-Ahx-SIARARAGS*RLSAEERQ [ residues 131 - 140 of human]
SA388 Antibodies
£150.00
UHRF2   ubiquitin like with PHD and ring finger domains 2
MBP-UHRF2 (600 - 800) [DU 58005]
SA381 Antibodies
£150.00
UHRF2   ubiquitin like with PHD and ring finger domains 2
MBP-UHRF2 (1 - 300) [DU 53948]
SA380 Antibodies
£150.00
UHRF1   ubiquitin like with PHD and ring finger domains 1
MBP-UHRF1 (600 - 793)
SA379 Antibodies
£150.00
RASSF7   Ras association domain family member 7
CKKRCLIRAS*LPVKPR [residues 105 - 117 of human]
SA360 Antibodies
£150.00
NUSAP1   nucleolar and spindle associated protein 1
CKKKLTTEATQT*PVSNKK [residues 341 - 355 of human]
SA359 Antibodies
£150.00
AFDN   afadin, adherens junction formation factor
CKKTSFTRTIS*NPEVVMKR [residues 209 - 224 of human]
SA346 Antibodies
£150.00
PANK4 AQRARSGT*FDLLEMDR [residues 399 - 414 of human] SA341 Antibodies
£150.00
FERMT2   fermitin family member 2
CKKPGSGSIYSS*PGLYSKTM [residues 173 - 189 of human]
SA340 Antibodies
£150.00
MAP1S KKRASRPLS*ARSEPSE [residues 893 - 907 of human] SA339 Antibodies
£150.00
CDKL5   cyclin dependent kinase like 5
CKKNLAGASLS*PLHTKTYQ [residues 370 - 386 of human]
SA355 Antibodies
£150.00
RAB43 CAGQERFRT*ITQSYYR [residues 75 - 89 of human] SA334 Antibodies
£150.00
RNF12   ring finger protein, LIM domain interacting
QRRARS*RS*PEHRR [residues 207 - 219 of human]
SA310 Antibodies
£150.00
RAB35 GST-RAB35 [DU 26867] SA314 Antibodies
£150.00
RUBCNL   rubicon like autophagy enhancer
GST-KIAA0226L (1 - 440) [DU 26405]
SA297 Antibodies
£150.00
FAM83H   Family with sequence similarity 83 member H
GST-FAM83H [DU 28403]
SA273 Antibodies
£150.00
KCC3A potassium chloride cotransporter 3
IEDLSQNS*ITGEHSQ [residues 89 - 103 of human]
S042D Antibodies
£150.00
KCC3A potassium chloride cotransporter 3
CYQEKVHMT*WTKDKYM [residues 1041 - 1055 of human]
S961C Antibodies
£150.00
KCC3A potassium chloride cotransporter 3
SAYTYERT*LMMEQRSRR [residues 984 - 998 of human ]
S959C Antibodies
£150.00
RAB35 CRILVGNKNDDPERKVVETEDAYKFAGQMGI [residues 114 - 144 of human] SA101 Antibodies
£150.00
RAB12 CKSTVGVDFKIKTVELRGKKIRLQIWDTAGQER [residues 71 - 103 of human] SA100 Antibodies
£150.00
RAB5A CKKLPKNEPQNPGANSARGRGVDLTEPTQPTRN (residues 179 - 210 of human) SA099 Antibodies
£150.00
RAB3A CDMEDERVVSSERGRQLADHLGFEFFEASAK [residues 137 - 167 of human] SA098 Antibodies
£150.00
USP26 GST-USP26 (554 - 753 mouse) [DU 53038] SA085 Antibodies
£150.00
Rab35 AGQERFRT*ITSTYYR [residues 65 - 79 of human] SA083 Antibodies
£150.00
Rab3A AGQERYRT*ITTAYYR [residues 79 - 93 of human] SA082 Antibodies
£150.00
RAB8A RAB8A, member RAS oncogene family
CKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFR [residues 172 - 203 of human]
S969D Antibodies
£150.00
Spt5 His-Spt5 (792 - 1013 yeast) [DU 47650] SA016 Antibodies
£150.00
RAB39B GST-RAB39B [DU 43849] S935D Antibodies
£150.00
RAB7L   His-SUMO-RAB7L (1 - 203) [DU 50291] S984D Antibodies
£150.00
Filamin Filamin
CSKTRGGETKREVRVEEST [residues 2160 - 2177 of human]
R1899 Antibodies
£150.00
IRS Insulin Receptor Substrate 1
RTESITATS*PASMVGGKK [residues 299 - 315 of mouse]
S487A Antibodies
£150.00
p70 S6 Kinase 2   p70 ribosomal protein S6 kinase 2 (mouse)
RPPSGTKKSKKGRGRSGR [residues 468 - 485 of mouse]
S470A Antibodies
£150.00