Search Results

Title Detail Species Tag Identifier Product type Price Add to cart
USP38 Ubiquitin Specific Protease 38
GST-USP38 (1 - 231 mouse) [DU 49045]
S704D Antibodies
£150.00
USP34 GST-USP34 (3384 - 5582 mouse) S703D Antibodies
£150.00
EPHA2 GST-EPHA2 (878 - 977 mouse) S700D Antibodies
£150.00
BRCA1   BRCA1 DNA repair associated
GST-BRCA1 (325 - 551 mouse) [DU 49085]
S699D Antibodies
£150.00
BRD4 GST-BRD4 [DU 46251] S698D Antibodies
£150.00
USP38 Ubiquitin Specific Protease 38
GST-USP38 (952 - 1042 mouse)
S694D Antibodies
£150.00
BRCA1 GST-BRCA1 (1247 - 1450 mouse) S693D Antibodies
£150.00
STK24 GST-STK24 (311 - 431 mouse) [DU 49051] S692D Antibodies
£150.00
RNF12   ring finger protein, LIM domain interacting
GST-RNF12 (1 - 271 mouse) [DU 49042]
S691D Antibodies
£150.00
SV2A   synaptic vesicle glycoprotein 2A
CKKRVQDEYS*RRS*YS*RFEEEDDKK [residues 36 - 54 of human]
S686D Antibodies
£150.00
Optineurin Optineurin
RHGARTSDSDQQ [residues 520 - 531 of human]
S685D Antibodies
£150.00
Optineurin Optineurin
RLQEKCQALERKNS [residues 329 - 342 of human]
S685D Antibodies
£150.00
Spindly His-Spindly S683D Antibodies
£150.00
HHARI GST-HHARI [DU 22966] S622D Antibodies
£150.00
SV2A synaptic vesicle glycoprotein 2A
RRGGASSDAT*EGHDEDDRR [residues 77 - 91 of human]
S679D Antibodies
£150.00
SV2A synaptic vesicle glycoprotein 2A
RREEGGASS*DAT*EGHDERR [residues 75 - 89 og human]
S678D Antibodies
£150.00
SV2A synaptic vesicle glycoprotein 2A
RREEGGAS*SDAT*EGHDERR [residues 75 - 89 of human]
S677D Antibodies
£150.00
SPAK Serine/threonine-protein kinase 39
GST-SPAK (424 - 556 mouse) [DU 44891]
S669D Antibodies
£150.00
SPAK Serine/threonine-protein kinase 39
GST-SPAK (2 - 76 mouse) [DU 44920]
S668D Antibodies
£150.00
CaCUL GST-CaCUL [DU 22997] S579D Antibodies
£150.00
CaCUL GST-CaCUL (1 - 180) [DU 22960] S577D Antibodies
£150.00
TRAF6 TNF receptor-associated factor 6, E3 ubiquitin protein ligase
GST-TRAF6 (mouse) [DU 32056]
S597D Antibodies
£150.00
ALPK1 GST-ALPK1 (1 - 358) [DU 43606] S593D Antibodies
£150.00
SLX41P SLX41P (200 - end) [DU 45509] S587D Antibodies
£150.00
SLX41P SLX41P (50 - 250) [DU 45577] S586D Antibodies
£150.00
MSANTD2 MSANTD2 (50 - 250) [DU 45574] S584D Antibodies
£150.00
KIAA2022 GST-KIAA2022 (300 - 600) [DU 45522] S574D Antibodies
£150.00
PPM1E protein phosphatase 1E (PP2C domain containing)
GST-PPM1E (1 - 755) [DU 39687]
S569D Antibodies
£150.00
SIK2 Salt Inducible Kinase 2
GST-SIK2 (272 - 445 mouse) [DU 43597]
S567D Antibodies
£150.00
NLGN3 CPPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENAPGSWNGDQDAGPLLVEN [residues 627 - 677 of human] S565D Antibodies
£150.00
FBW7 FBW7 (118 - 227) [DU 23944] S562D Antibodies
£150.00
Ubiquitin RNIQKES*TLHLVLR [residues 60 - 72 of human] S561D Antibodies
£150.00
OTUD4 GST-OTUD4 (860 - end) DU 45399 S559D Antibodies
£150.00
KIAA2022 GST-KIAA2022 (1 - 300) [DU 45225] S555D Antibodies
£150.00
SPAK   Serine/threonine-protein kinase 39
GST-SPAK [DU 6040]
S551D Antibodies
£150.00
UBQLN4   ubiquilin 4
CPRTSVPLAGSNSGSSAEA [residues 491 - 508 of human]
S536D Antibodies
£150.00
UBQLN3   ubiquilin 3
RRTIGTECPSPPVSIPGPNPGEIPQ [residues 95 - 119 of human]
S535D Antibodies
£150.00
UBQLN1   ubiquilin 1
QSTSGPSLVPGAG [residues 350 - 362 of human]
S534D Antibodies
£150.00
TUBG Tubulin gamma
CNIMTS*PYSK [residues 76 - 84 of Drosophila]
S511D Antibodies
£150.00
TUBG Tubulin gamma
CSILNS*PYAK [residues 76 - 84 of human]
S511D Antibodies
£150.00
OTUB1   OTU domain, ubiquitin aldehyde binding 1
KQEPLGS*DS*EGVNCLA [residues 10 - 25 of human]
S520D Antibodies
£150.00
TubGCP2 KTSDVNSAAGSV [residues 36 - 47 of Drosophila] S521D Antibodies
£150.00
TubGCP2 KMCVEDAIG [residues 844 - 852 of Drosophila] S521D Antibodies
£150.00
TubGCP2 CPLLS*QES [residues 193 - 199 of Drosophila] S516D Antibodies
£150.00
TubGCP2 CPLAS*QES [residues 209 - 215 of human] S516D Antibodies
£150.00
OTULIN OTU Deubiquitinase With Linear Linkage Specificity
OTULIN (GST cleaved) [DU 43487]
S529D Antibodies
£150.00
IRAK3   Interleukin-1 Receptor-Associated Kinase 3
GST-IRAK3 (mouse) [DU 39882]
S528D Antibodies
£150.00
AMPK CMDDSAMHIPPGLKPH [residues 353 - 366 of human] S525D Antibodies
£150.00
IRF5   interferon regulatory factor 5
IRLQIS*NPDLK [residues 457 - 467 of human]
S509D Antibodies
£150.00
SAPK2A   Stress-activated protein kinase
GST-SAPK2A [DU 979]
S508A Antibodies
£150.00