Search Results

Title Detail Species Tag Identifier Product type Price Add to cart
NLGN3 CPPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENAPGSWNGDQDAGPLLVEN [residues 627 - 677 of human] S565D Antibodies
£150.00
FBW7 FBW7 (118 - 227) [DU 23944] S562D Antibodies
£150.00
Ubiquitin RNIQKES*TLHLVLR [residues 60 - 72 of human] S561D Antibodies
£150.00
OTUD4 GST-OTUD4 (860 - end) DU 45399 S559D Antibodies
£150.00
KIAA2022 GST-KIAA2022 (1 - 300) [DU 45225] S555D Antibodies
£150.00
SPAK   Serine/threonine-protein kinase 39
GST-SPAK [DU 6040]
S551D Antibodies
£150.00
UBQLN4   ubiquilin 4
CPRTSVPLAGSNSGSSAEA [residues 491 - 508 of human]
S536D Antibodies
£150.00
UBQLN3   ubiquilin 3
RRTIGTECPSPPVSIPGPNPGEIPQ [residues 95 - 119 of human]
S535D Antibodies
£150.00
UBQLN1   ubiquilin 1
QSTSGPSLVPGAG [residues 350 - 362 of human]
S534D Antibodies
£150.00
TUBG Tubulin gamma
CNIMTS*PYSK [residues 76 - 84 of Drosophila]
S511D Antibodies
£150.00
TUBG Tubulin gamma
CSILNS*PYAK [residues 76 - 84 of human]
S511D Antibodies
£150.00
OTUB1   OTU domain, ubiquitin aldehyde binding 1
KQEPLGS*DS*EGVNCLA [residues 10 - 25 of human]
S520D Antibodies
£150.00
TubGCP2 KTSDVNSAAGSV [residues 36 - 47 of Drosophila] S521D Antibodies
£150.00
TubGCP2 KMCVEDAIG [residues 844 - 852 of Drosophila] S521D Antibodies
£150.00
TubGCP2 CPLLS*QES [residues 193 - 199 of Drosophila] S516D Antibodies
£150.00
TubGCP2 CPLAS*QES [residues 209 - 215 of human] S516D Antibodies
£150.00
OTULIN OTU Deubiquitinase With Linear Linkage Specificity
OTULIN (GST cleaved) [DU 43487]
S529D Antibodies
£150.00
IRAK3   Interleukin-1 Receptor-Associated Kinase 3
GST-IRAK3 (mouse) [DU 39882]
S528D Antibodies
£150.00
AMPK CMDDSAMHIPPGLKPH [residues 353 - 366 of human] S525D Antibodies
£150.00
IRF5   interferon regulatory factor 5
IRLQIS*NPDLK [residues 457 - 467 of human]
S509D Antibodies
£150.00
SAPK2A   Stress-activated protein kinase
GST-SAPK2A [DU 979]
S508A Antibodies
£150.00
BCR Breakpoint cluster region
KAQFPDSEPPRMELRSVGDIEQ [reisdues 12 - 33 of human]
S484C Antibodies
£150.00
MAPKAP-K2 MAPK-activated protein kinase
KVPQT*PLHC [residues 330 - 337 of human + C-terminal cysteine for coupling]
S813A Antibodies
£150.00
TUBG   Tubulin gamma
YPQWSPAVEASKAG [residues 444 - 457 of Drosophila]
S491D Antibodies
£150.00
TPS   Trehalose Phosphate Synthase 5
RDMVSRS*YSNLLD [residues 16 - 28 of Arabidopsis]
S214B Antibodies
£150.00
PAIP2 poly(A) binding protein interacting protein 2
CPSRSST*SPSIIN [residues 2 - 13 of human + N-terminal cysteine for coupling]
S045C Antibodies
£150.00
FUS Fusion (involved in t(12;16) in malignant liposarcoma)
KKNDYTQQAT*QSYGAYP [ residues 4 - 19 of human]
S781B Antibodies
£150.00
ILK Integrin Linked Kinase
Unknown immunogen
S956 Antibodies
£150.00
SKP1 S-Phase Kinase-Associated Protein 1
GST-SKP1 (95 - end S. cerevisiae) [DU 37909]
S284D Antibodies
£150.00
PP4R2   Protein Phosphatase 4 Regulatory Subunit 2
ENDDEATEVTDEPMEQD [residues 478 - 495 of human]
S029C Antibodies
£150.00
NEDD4.2 neural precursor cell expressed, developmentally down-regulated 4-like
CHMRSKT*SLNPN [residues 414 - 424 of human Q96PU5-4 or residues 515 - 525 of human Q96PU5-5 + N-terminal cysteine for coupling]
S612B Antibodies
£150.00
E1A binding protein p300 E1A binding protein p300
AENVVEPGPPSAK [residues 2 - 14 of human]
S714 Antibodies
£150.00
DEAF1   Deformed Epidermal Auroregulatory Factor 1
GST-DEAF1 (mouse) [DU 39471]
S338D Antibodies
£150.00
Pellino1 pellino homolog 1
NKDQHS*ISY [residues 71 - 79 of human]
S398C Antibodies
£150.00
ZNRF2 zinc and ring finger 2
GST-ZNRF2 (mouse) DU 36367
S098D Antibodies
£150.00
TAB TAK1 binding protein
SQPTPS*PAPAA [residues 373 - 383 of human]
S789B Antibodies
£150.00
Cysteine Proteinase RD21 Cysteine Proteinase RD21
CLLSKNSPFSVKALKRK [residues 432 - 448 of Arabidopsis]
S614A Antibodies
£150.00
PPM1E   protein phosphatase, Mg2+/Mn2+ dependent 1E
GST-PPM1E (495 - 755) [DU 15986]
S677C Antibodies
£150.00
SAPK4   Stress-activated protein kinase
Unknown Immunogen
S756 Antibodies
£150.00
c-Jun V-jun avian sarcoma virus 17 oncogene homolog
NGHITTTPT*PTQFLCPK [residues 85 - 101 of human]
S679A Antibodies
£150.00
MARK Microtubile affinity regulating kinase
TVGGKLDT*FCGS*PPY [residues 204 - 218 of human
S370B Antibodies
£150.00
TTBK2 tau tubulin kinase 2
GST-TTBK2 (300 - 630) [DU 19043]
S533C Antibodies
£150.00
NHE1 Na(+)/H(+) exchanger
RARIGS*DPLAY [residues 698 - 708 of human]
S176B Antibodies
£150.00
ELK ETS domain-containing protein Elk-4
CTLSGLEGPSLPGPFSPRL [residues 410- 427of mouse, plus cysteine at N-terminus for coupling]
S551B Antibodies
£150.00
PIM Provirus integration site for Moloney murine leukaemia virus
GLAELDSSNEDAGTK [residues 459 - 473 of human]
S478B Antibodies
£150.00
ERCC1 GST-ERCC1 (1 - 200 mouse) [DU 37165] S161D Antibodies
£150.00
TAB TAK1 binding protein
YMEYHS*PEDNR [residues 55 - 65 of mouse]
S905B Antibodies
£150.00
PINK PTEN induced putative kinase 1
PINK (235 - end mouse MBP cleaved) [DU 17570]
S774C Antibodies
£150.00
UBE2T   Ubiquitin conjugating enzyme E2T
UBE2T (1 - 197 GST cleaved)
S820C Antibodies
£150.00
SGK Serum and glucocorticoid-induced kinase
GST-SGK3 PX domain [DU 2034]
S918B Antibodies
£150.00