Search Results
| Title | Detail | Species | Tag | Identifier | Product type | Price | Add to cart |
|---|---|---|---|---|---|---|---|
| ALPK1 | GST-ALPK1 (1 - 358) [DU 43606] | S593D | Antibodies | £150.00
|
|||
| SLX41P | SLX41P (200 - end) [DU 45509] | S587D | Antibodies | £150.00
|
|||
| SLX41P | SLX41P (50 - 250) [DU 45577] | S586D | Antibodies | £150.00
|
|||
| MSANTD2 | MSANTD2 (50 - 250) [DU 45574] | S584D | Antibodies | £150.00
|
|||
| KIAA2022 | GST-KIAA2022 (300 - 600) [DU 45522] | S574D | Antibodies | £150.00
|
|||
| PPM1E | protein phosphatase 1E (PP2C domain containing) GST-PPM1E (1 - 755) [DU 39687] |
S569D | Antibodies | £150.00
|
|||
| SIK2 | Salt Inducible Kinase 2 GST-SIK2 (272 - 445 mouse) [DU 43597] |
S567D | Antibodies | £150.00
|
|||
| NLGN3 | CPPDTTHSSHITRRPNGKTWSTKRPAISPAYSNENAPGSWNGDQDAGPLLVEN [residues 627 - 677 of human] | S565D | Antibodies | £150.00
|
|||
| FBW7 | FBW7 (118 - 227) [DU 23944] | S562D | Antibodies | £150.00
|
|||
| Ubiquitin | RNIQKES*TLHLVLR [residues 60 - 72 of human] | S561D | Antibodies | £150.00
|
|||
| OTUD4 | GST-OTUD4 (860 - end) DU 45399 | S559D | Antibodies | £150.00
|
|||
| KIAA2022 | GST-KIAA2022 (1 - 300) [DU 45225] | S555D | Antibodies | £150.00
|
|||
| SPAK | Serine/threonine-protein kinase 39 GST-SPAK [DU 6040] |
S551D | Antibodies | £150.00
|
|||
| UBQLN4 | ubiquilin 4 CPRTSVPLAGSNSGSSAEA [residues 491 - 508 of human] |
S536D | Antibodies | £150.00
|
|||
| UBQLN3 | ubiquilin 3 RRTIGTECPSPPVSIPGPNPGEIPQ [residues 95 - 119 of human] |
S535D | Antibodies | £150.00
|
|||
| UBQLN1 | ubiquilin 1 QSTSGPSLVPGAG [residues 350 - 362 of human] |
S534D | Antibodies | £150.00
|
|||
| TUBG | Tubulin gamma CNIMTS*PYSK [residues 76 - 84 of Drosophila] |
S511D | Antibodies | £150.00
|
|||
| TUBG | Tubulin gamma CSILNS*PYAK [residues 76 - 84 of human] |
S511D | Antibodies | £150.00
|
|||
| OTUB1 | OTU domain, ubiquitin aldehyde binding 1 KQEPLGS*DS*EGVNCLA [residues 10 - 25 of human] |
S520D | Antibodies | £150.00
|
|||
| TubGCP2 | KTSDVNSAAGSV [residues 36 - 47 of Drosophila] | S521D | Antibodies | £150.00
|
|||
| TubGCP2 | KMCVEDAIG [residues 844 - 852 of Drosophila] | S521D | Antibodies | £150.00
|
|||
| TubGCP2 | CPLLS*QES [residues 193 - 199 of Drosophila] | S516D | Antibodies | £150.00
|
|||
| TubGCP2 | CPLAS*QES [residues 209 - 215 of human] | S516D | Antibodies | £150.00
|
|||
| OTULIN | OTU Deubiquitinase With Linear Linkage Specificity OTULIN (GST cleaved) [DU 43487] |
S529D | Antibodies | £150.00
|
|||
| IRAK3 | Interleukin-1 Receptor-Associated Kinase 3 GST-IRAK3 (mouse) [DU 39882] |
S528D | Antibodies | £150.00
|
|||
| AMPK | CMDDSAMHIPPGLKPH [residues 353 - 366 of human] | S525D | Antibodies | £150.00
|
|||
| IRF5 | interferon regulatory factor 5 IRLQIS*NPDLK [residues 457 - 467 of human] |
S509D | Antibodies | £150.00
|
|||
| SAPK2A | Stress-activated protein kinase GST-SAPK2A [DU 979] |
S508A | Antibodies | £150.00
|
|||
| BCR | Breakpoint cluster region KAQFPDSEPPRMELRSVGDIEQ [reisdues 12 - 33 of human] |
S484C | Antibodies | £150.00
|
|||
| MAPKAP-K2 | MAPK-activated protein kinase KVPQT*PLHC [residues 330 - 337 of human + C-terminal cysteine for coupling] |
S813A | Antibodies | £150.00
|
|||
| TUBG | Tubulin gamma YPQWSPAVEASKAG [residues 444 - 457 of Drosophila] |
S491D | Antibodies | £150.00
|
|||
| TPS | Trehalose Phosphate Synthase 5 RDMVSRS*YSNLLD [residues 16 - 28 of Arabidopsis] |
S214B | Antibodies | £150.00
|
|||
| PAIP2 | poly(A) binding protein interacting protein 2 CPSRSST*SPSIIN [residues 2 - 13 of human + N-terminal cysteine for coupling] |
S045C | Antibodies | £150.00
|
|||
| FUS | Fusion (involved in t(12;16) in malignant liposarcoma) KKNDYTQQAT*QSYGAYP [ residues 4 - 19 of human] |
S781B | Antibodies | £150.00
|
|||
| ILK | Integrin Linked Kinase Unknown immunogen |
S956 | Antibodies | £150.00
|
|||
| SKP1 | S-Phase Kinase-Associated Protein 1 GST-SKP1 (95 - end S. cerevisiae) [DU 37909] |
S284D | Antibodies | £150.00
|
|||
| PP4R2 | Protein Phosphatase 4 Regulatory Subunit 2 ENDDEATEVTDEPMEQD [residues 478 - 495 of human] |
S029C | Antibodies | £150.00
|
|||
| NEDD4.2 | neural precursor cell expressed, developmentally down-regulated 4-like CHMRSKT*SLNPN [residues 414 - 424 of human Q96PU5-4 or residues 515 - 525 of human Q96PU5-5 + N-terminal cysteine for coupling] |
S612B | Antibodies | £150.00
|
|||
| E1A binding protein p300 | E1A binding protein p300 AENVVEPGPPSAK [residues 2 - 14 of human] |
S714 | Antibodies | £150.00
|
|||
| DEAF1 | Deformed Epidermal Auroregulatory Factor 1 GST-DEAF1 (mouse) [DU 39471] |
S338D | Antibodies | £150.00
|
|||
| Pellino1 | pellino homolog 1 NKDQHS*ISY [residues 71 - 79 of human] |
S398C | Antibodies | £150.00
|
|||
| ZNRF2 | zinc and ring finger 2 GST-ZNRF2 (mouse) DU 36367 |
S098D | Antibodies | £150.00
|
|||
| TAB | TAK1 binding protein SQPTPS*PAPAA [residues 373 - 383 of human] |
S789B | Antibodies | £150.00
|
|||
| Cysteine Proteinase RD21 | Cysteine Proteinase RD21 CLLSKNSPFSVKALKRK [residues 432 - 448 of Arabidopsis] |
S614A | Antibodies | £150.00
|
|||
| PPM1E | protein phosphatase, Mg2+/Mn2+ dependent 1E GST-PPM1E (495 - 755) [DU 15986] |
S677C | Antibodies | £150.00
|
|||
| SAPK4 | Stress-activated protein kinase Unknown Immunogen |
S756 | Antibodies | £150.00
|
|||
| c-Jun | V-jun avian sarcoma virus 17 oncogene homolog NGHITTTPT*PTQFLCPK [residues 85 - 101 of human] |
S679A | Antibodies | £150.00
|
|||
| MARK | Microtubile affinity regulating kinase TVGGKLDT*FCGS*PPY [residues 204 - 218 of human |
S370B | Antibodies | £150.00
|
|||
| TTBK2 | tau tubulin kinase 2 GST-TTBK2 (300 - 630) [DU 19043] |
S533C | Antibodies | £150.00
|
|||
| NHE1 | Na(+)/H(+) exchanger RARIGS*DPLAY [residues 698 - 708 of human] |
S176B | Antibodies | £150.00
|