Recombinant Protein - ORF7A SARS-CoV2

Name: ORF7A SARS-CoV2
Price per aliquot (100µg): £110.00
Long Name:
ORF7A (1 - 121) SARS-CoV2
Synonyms:
SARS-CoV2-ORF7A, SARS-CoV-2 ORF7A, ORF7A SARS-CoV-2
Catalog Number (DU Number):
DU 68508
Accession:
QHD43421.1
Expression:
bacteria
Tag and Terminus:
N-Term
MBP
Uncleaved
Purification Method:
Amylose Resin
Calculated molecular mass:
Mono-Isotopic Mass: 57, 946.52 daltons
Average Mass: 57, 983.09 daltons
Purity:
85 %
Storage Buffer:
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
Storage Temperature:
-70 °C
Theoretical PI:
5.18
Gel Information :
  • Gel Image 1: 
Native Sequence:
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELVKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGDDDDKVPEFLEVLFQGPLGSMKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE Amino acids M1 – E121 (end). Residue M404 of the fusion protein is equivalent to M1 of the native enzyme. The MBP tag is located at residues 1 – 367.
Protease Cleavage:
PreScission (LEVLFQGP) residues 393 – 400

Do you need any help? Please get in touch and we’ll be happy to lend a hand.