cDNA Clone - (mu) MYCBP2

Name: (mu) MYCBP2
Price per aliquot: £125.00
Expressed:
Mouse Mycbp2
Plasmid:
pSc-B-(mu)MYCBP2 nt6292 - 10,107
Parental Plasmid:
pSC-B
View Parent Plasmid

Snapgene File | Genbank File
ATGACCATGATTACGCCAAGCGCGCAATTAACCCTCACTAAAGGGAACAAAAGCTGGGTACCGGGCCCCCCCTCGAGGTCGACGGTATCGATAAGCTTGATATCCACTGTGGAATTCGCCCTTAAGGGCGAATTCCACATTGGTCGCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCACCGCGGGAGCTCCAATTCGCCCTATAGTGAGTCGTATTACGCGCGCTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATTAAATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAGTCAGAAGAACTCGTCAAGAAGGCGATAGAAGGCGATGCGCTGCGAATCGGGAGCGGCGATACCGTAAAGCACGAGGAAGCGGTCAGCCCATTCGCCGCCAAGTTCTTCAGCAATATCACGGGTAGCCAACGCTATGTCCTGATAGCGGTCCGCCACACCCAGCCGGCCACAGTCGATGAATCCAGAAAAGCGGCCATTTTCCACCATGATATTCGGCAAGCAGGCATCGCCATGGGTCACGACGAGATCCTCGCCGTCGGGCATGCTCGCCTTGAGCCTGGCGAACAGTTCGGCTGGCGCGAGCCCCTGATGTTCTTCGTCCAGATCATCCTGATCGACAAGACCGGCTTCCATCCGAGTACGTGCTCGCTCGATGCGATGTTTCGCTTGGTGGTCGAATGGGCAGGTAGCCGGATCAAGCGTATGCAGCCGCCGCATTGCATCAGCCATGATGGATACTTTCTCGGCAGGAGCAAGGTGAGATGACAGGAGATCCTGCCCCGGCACTTCGCCCAATAGCAGCCAGTCCCTTCCCGCTTCAGTGACAACGTCGAGCACAGCTGCGCAAGGAACGCCCGTCGTGGCCAGCCACGATAGCCGCGCTGCCTCGTCTTGCAGTTCATTCAGGGCACCGGACAGGTCGGTCTTGACAAAAAGAACCGGGCGCCCCTGCGCTGACAGCCGGAACACGGCGGCATCAGAGCAGCCGATTGTCTGTTGTGCCCAGTCATAGCCGAATAGCCTCTCCACCCAAGCGGCCGGAGAACCTGCGTGCAATCCATCTTGTTCAATCATTAGTGTCCTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTTAATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGGACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGTCTATTCTTTTGATTTACAGTTAATTAAAGGGAACAAAAGCTGGCATGTACCGTTCGTATAGCATACATTATACGAACGGTACGCTCCAATTCGCCCTTTAATTAACTGTTCCAACTTTCACCATAATGAAATAAGATCACTACCGGGCGTATTTTTTGAGTTGTCGAGATTTTCAGGAGCTAAGGAAGCTAAAATGGAGAAAAAAATCACTGGATATACCACCGAGTACTGCGATGAGTGGCAGGGCGGGGCGTAATTTTTTTAAGGCAGTTATTGGTGCCCTTAAACGCCTGGTTGCTACGCCTGAATAAGTGATAATAAGCGGATGAATGGCAGAAATTCGAAAGCAAATTCGACCCGGTCGTCGGTTCAGGGCAGGGTCGTTAAATAGCCGCTTATGTCTATTGCTGGTTTACCGGTTTATTGACTACCGGAAGCAGTGTGACCGTGTGCTTCTCAAATGCCTGAGGCCAGTTTGCTCAGGCTCTCCCCGTGGAGGTAATAATTGACGATATGATCCTTTTTTTCTGATCAAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTTCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTCCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCT
DU Number:
DU65485
Species:
Mouse
Sequence of Insert:
View Sequence

GGATCCTCTGGATGGCCTACTATGGTTTTAGTGTTGCCAGGAAATGAAGC CCTTTTCTCACTGGAAACTGCTTCAGATTATGTGAAAGATGACAAAGCCT CCTTCTATGGGTTCAAGTGTTTTGCAATTGGATATGAATTTAGCCCTGGA CCTGATGAGGGAGTTATTCAGCTGGAAAAAGAATTAGCCAATCTTGGTGG GGTTTGTGCCGCAGCCCTGATGAAGAAGGATCTCGCACTGCCTGTTGGTA ACGAGTTGGAGGAAGATCTTGAAATTCTTGAAGAGGCTGCATTGCAGGTG TGCAAAACTCACTCTGGCATTCTTGGAAAGGGTTTGGCTCTTTCTCATTC ACCAACTATCTTAGAGGCACTTGAAGGAAACTTGCCGCTTCAAATCCAAA GCAATGAGCAGTCCTTTCTGGATGATTTCATTGCTTGTGTCCCAGGGTCA AGTGGTGGAAGGCTTGCAAGATGGCTTCAGCCAGATTCCTATGCTGACCC TCAGAAAACTTCGTTGATTCTGAATAAGGATGATATTCGCTGTGGCTGGC CCACCACCATAACTGTTCAAACAAAAGACCAATATGGCGATGTGGTTCAT GTTCCCAACATGAAGGTGGAAGTGAAAGCTGTACCTGTTTCTCAGAAAAA AACATCTTTGCAGCAAGATCAAGGAAAGAAATGTCAAAGGATTCCTGGCA GCCCCTCAGCAGCAGCTTCTAGCGCCGACATGACTTTTGGTGGGTTGGCA TCCCCAAAGCTGGACGTCTCGTATGAGCCAATGATCGTCAAGGAGGCGCG GTATATTGCCATAACAATGATGAAGGTATATGAAAACTACTCATTTGAAG AACTGCGTTTTGCATCACCAACTCCGAAAAGGCCCAGTGAAAATATGCTT ATTCGTGTCAATAACGATGGGACCTACTGTGCAAACTGGACTCCAGGGGC TATCGGGCTCTACACTGTTCATGTGACCATTGATGGCATTGAAATAGATG CTGGCCTTGAAGTAAAAGTCAAAGATCCACCAAAGGGGATGATCCCCCCA GGGACTCAGCTAGTCAAGCCGAAGGCAGACCCCCAGCCAAATAAGATTCG AAAATTTGTGGCCAAGGACAGTGCTGGTCTCCGCATCCGGAGCCACCCTT CCCTTCAGAGTGAACAGATTGGAATAGTGAGAGTCAATGGAACTATCACT TTTATTGATGAGATCCACAATGATGATGGCGTGTGGTTGAGACTGAATGA GGAGACAATAAAGAAGTATGTTCCTAACATGAACGGTTACACTGAAGCCT GGTGCCTCTCTTTTAACCAGCATCTTGGCAAGAGCCTTCTGGTCCCTGTT GACGAACCTAAAACTAATACTGATGACTTTTTCAAAGACATGAACTCCTG CGGCCCACAGGAAGCAACAATGCAAGAACGAGATCACCCGTTCTTGAGAG GTGGGCCAGGCATGTACAAGGTAGTGAAGACGGGGCCTTCAGGTCACAAC ATCAGAAGCTGCCCTAACCTTAGAGGTATCCCAATTGGAATGTTAGTTCT GGGAAACAAAGTCAAAGCAGTGGGAGAGGTAACCAATTCTGAAGGTGCAT GGGTGCAGCTGGATAAGAACAGCATGGTAGAATTCTGTGAGAGTGATGAA GGAGAGGCATGGTCCTTAGCTAGAGACAGAGGCGGAAACCAGTACCTACG GCATGAAGATGAACAAGTTCTGCTGGATCAGAATTCTCAACCTCCTCCTC CAAGCCCTTTCTCAGTACAAGCTTTCAATAAAGGGGCAAGTTGCAGTGCC CAAGGATTTGACTATGGCCTGGGAAATAACAAAGGTGACAGAGGAACTAT CTCAACATCTTCAAGACCAGTGTCCACATCAGGGAAGTCAGAGCTGCCCT CTAAGCACAGCAGGTCAGTTAAACCCGACGGGCATGTGAGCCGGACTCCT GCTGACCAGAAGAAGCCACGGGGGACAGAAGGCTTATCTGCTAGTGAATC CCTCATGTTAAAATCTGATGCTGCAAAGTTGAGGTCAGACTCCCATAGTA GGTCCCTGTCCCCTAACCATAACACTCTGCAGACACTGAAGTCTGATGGG AGGACGTCTTCTGGCTTCAGGGCCGAATCCCCAGGACCAGGCTCGAGGTC ATCCTCCCCTAAGCCCAAGCCTCTGCCGACTCCCAGGTCTAGCCCATCTG GTGCAAGCTCTCCACGCTCCTCCTCACCACAGGATAAAAATCTACCTCAG AAAAGCACAGCTCCTGCTAAGACAAAACTTGACCCACCTCGGGAACGTTC CAAGTCAGACTCATATACACTTGATCCAGATACCCTCCGTAAGAAGAAAA TGCCCCTCACAGAACCATTAAGGGGGCGGTCCACATCACCAAAACCAAAA CCAGTACCAAAGGATCCTAAAGACTCCCCAGGGTCTGAAAACAGAGCCCC TTCTCCCCACGTAGTGCAGGAAAACCTCCACAGTGAGGTAGTTGAAGTCT GTACTTCAAGTACTTTAAAAACAAATGGTGTCACGGACAGCACCTGCGAT GACAGCGGTGACTTGAAGAGTGTGGATGAAGGTTCAAATAAAGTGCATTT CAGCATAGGCAAAGCACCGCTGAAAGATGAACAGGAAATGAGAGCATCAC CCAAAATAAGTCGGAAGTGTGCTAACAGACACACCAGGCCCAAAAAAGAA AAGTCTAACTTCCTTTTCAAAGGAGATGGAACCAAATCTTTAGAACCAGC CAAGCAAGCCATGTCCCCGTCTGTGGCTGAGcGTGCCAGAGCCGTCTTTG CCTCTTTTTTGTGGCATGAAGGCATAGTACATGATGCAATGGCTTGTTCT TCCTTCCTGAAATTTAATCCTGACCTTTCCAAAGAACATGCTCCTATAAG AAGTAGTTTGAATAGCCAACCACCCACAGAGGAAAAGGAAATCAAGTTAA AAAATAGACATTCATTGGAAATATCGTCTGCTCTGAATATGTTTAACATT GCACCTCATGGCCCAGATATATCCAAGATGGGTAGTATCAACAAAAATAA GGTCTTGTCCATGCTTAAGGAACCGCCTCTCCATGAAAAATGTGAGGACG GGAAATCGGAAGCCACTTTTGAAATGTCCATGCATCACACAATGAAGTCG AAATCTCCACTTCCTTTAACATTACAACATTTAGTGGCTTTCTGGGAAGA TATCTCTTTGGCTACAATCAAAGCTGCTTCCCAGAATATGATTTTTCCAA GTCCTGGTTCCTGTGCAGTCCTTAAAAAGAAAGAATGTGAAAAAGAGAAT AAAAAAACAAAAAAGGAAAAAAAGAAAAAAGAAAAGACAGAAATTCGGCC AAGGGGCAATTTGTTTGGTGAAATGGCCCAGCTGGCTGTAGGAGGGCCAG AGAAAGATACCATCTGTGAGCTGTGTGGAGAATCCCATCCGTACCCAGTG ACATATCACATGAGACAAGCTCACCCAGGTTGTGGCCGATATGCTGGTGG ACAAGGATACAATAGCATTGGGCATTTTTGTGGAGGATGGGCTGGTAACT GTGGTGATGGGGGAATGGGAGGAAGCACTTGGTACC
Amino Acid Sequence:
View Sequence

GSSGWPTMVLVLPGNEALFSLETASDYVKDDKASFYGFKCFAIGYEFSPG PDEGVIQLEKELANLGGVCAAALMKKDLALPVGNELEEDLEILEEAALQV CKTHSGILGKGLALSHSPTILEALEGNLPLQIQSNEQSFLDDFIACVPGS SGGRLARWLQPDSYADPQKTSLILNKDDIRCGWPTTITVQTKDQYGDVVH VPNMKVEVKAVPVSQKKTSLQQDQGKKCQRIPGSPSAAASSADMTFGGLA SPKLDVSYEPMIVKEARYIAITMMKVYENYSFEELRFASPTPKRPSENML IRVNNDGTYCANWTPGAIGLYTVHVTIDGIEIDAGLEVKVKDPPKGMIPP GTQLVKPKADPQPNKIRKFVAKDSAGLRIRSHPSLQSEQIGIVRVNGTIT FIDEIHNDDGVWLRLNEETIKKYVPNMNGYTEAWCLSFNQHLGKSLLVPV DEPKTNTDDFFKDMNSCGPQEATMQERDHPFLRGGPGMYKVVKTGPSGHN IRSCPNLRGIPIGMLVLGNKVKAVGEVTNSEGAWVQLDKNSMVEFCESDE GEAWSLARDRGGNQYLRHEDEQVLLDQNSQPPPPSPFSVQAFNKGASCSA QGFDYGLGNNKGDRGTISTSSRPVSTSGKSELPSKHSRSVKPDGHVSRTP ADQKKPRGTEGLSASESLMLKSDAAKLRSDSHSRSLSPNHNTLQTLKSDG RTSSGFRAESPGPGSRSSSPKPKPLPTPRSSPSGASSPRSSSPQDKNLPQ KSTAPAKTKLDPPRERSKSDSYTLDPDTLRKKKMPLTEPLRGRSTSPKPK PVPKDPKDSPGSENRAPSPHVVQENLHSEVVEVCTSSTLKTNGVTDSTCD DSGDLKSVDEGSNKVHFSIGKAPLKDEQEMRASPKISRKCANRHTRPKKE KSNFLFKGDGTKSLEPAKQAMSPSVAERARAVFASFLWHEGIVHDAMACS SFLKFNPDLSKEHAPIRSSLNSQPPTEEKEIKLKNRHSLEISSALNMFNI APHGPDISKMGSINKNKVLSMLKEPPLHEKCEDGKSEATFEMSMHHTMKS KSPLPLTLQHLVAFWEDISLATIKAASQNMIFPSPGSCAVLKKKECEKEN KKTKKEKKKKEKTEIRPRGNLFGEMAQLAVGGPEKDTICELCGESHPYPV TYHMRQAHPGCGRYAGGQGYNSIGHFCGGWAGNCGDGGMGGSTWY
Bacterial Selection:
Amp, Kan
Low Growth Temperature Requirement?:
No
Comments:
From native BamHI site at nt6292 to native Kpn1 site at nt10,107. Comprises Gly2098-Tyr 3369 of full-length protein with the following changes: Deletion spanning N2549-Q2573, Deletion spanning D2735-S2786 and a single mutation at C3102>R (TGT > CGT)

Do you need any help? Please get in touch and we’ll be happy to lend a hand.