cDNA Clone - A20

Name: A20
Price per aliquot: £110.00
Expressed:
FLAG-A20 A586V
Plasmid:
pRetrox tight FLAG-A20 A586V
Parent Plasmid:
pRetrox tight FLAG
View Parent Plasmid

|
DU Number:
DU65478
Species:
Human
Sequence of Insert:
View Sequence

ggatctATGGCTGAACAAGTCCTTCCTCAGGCTTTGTATTTGAGCAATAT GCGGAAAGCTGTGAAGATACGGGAGAGAACTCCAGAAGACATTTTTAAAC CTACTAATGGGATCATTCATCATTTTAAAACCATGCACCGATACACACTG GAAATGTTCAGAACTTGCCAGTTTTGTCCTCAGTTTCGGGAGATCATCCA CAAAGCCCTCATCGACAGAAACATCCAGGCCACCCTGGAAAGCCAGAAGA AACTCAACTGGTGTCGAGAAGTCCGGAAGCTTGTGGCGCTGAAAACGAAC GGTGACGGCAATTGCCTCATGCATGCCACTTCTCAGTACATGTGGGGCGT TCAGGACACAGACTTGGTACTGAGGAAGGCGCTGTTCAGCACGCTCAAGG AAACAGACACACGCAACTTTAAATTCCGCTGGCAACTGGAGTCTCTCAAA TCTCAGGAATTTGTTGAAACGGGGCTTTGCTATGATACTCGGAACTGGAA TGATGAATGGGACAATCTTATCAAAATGGCTTCCACAGACACACCCATGG CCCGAAGTGGACTTCAGTACAACTCACTGGAAGAAATACACATATTTGTC CTTTGCAACATCCTCAGAAGGCCAATCATTGTCATTTCAGACAAAATGCT AAGAAGTTTGGAATCAGGTTCCAATTTCGCCCCTTTGAAAGTGGGTGGAA TTTACTTGCCTCTCCACTGGCCTGCCCAGGAATGCTACAGATACCCCATT GTTCTCGGCTATGACAGCCATCATTTTGTACCCTTGGTGACCCTGAAGGA CAGTGGGCCTGAAATCCGAGCTGTTCCACTTGTTAACAGAGACCGGGGAA GATTTGAAGACTTAAAAGTTCACTTTTTGACAGATCCTGAAAATGAGATG AAGGAGAAGCTCTTAAAAGAGTACTTAATGGTGATAGAAATCCCCGTCCA AGGCTGGGACCATGGCACAACTCATCTCATCAATGCCGCAAAGTTGGATG AAGCTAACTTACCAAAAGAAATCAATCTGGTAGATGATTACTTTGAACTT GTTCAGCATGAGTACAAGAAATGGCAGGAAAACAGCGAGCAGGGGAGGAG AGAGGGGCACGCCCAGAATCCCATGGAACCTTCCGTGCCCCAGCTTTCTC TCATGGATGTAAAATGTGAAACGCCCAACTGCCCCTTCTTCATGTCTGTG AACACCCAGCCTTTATGCCATGAGTGCTCAGAGAGGCGGCAAAAGAATCA AAACAAACTCCCAAAGCTGAACTCCAAGCCGGGCCCTGAGGGGCTCCCTG GCATGGCGCTCGGGGCCTCTCGGGGAGAAGCCTATGAGCCCTTGGCGTGG AACCCTGAGGAGTCCACTGGGGGGCCTCATTCGGCCCCACCGACAGCACC CAGCCCTTTTCTGTTCAGTGAGACCACTGCCATGAAGTGCAGGAGCCCCG GCTGCCCCTTCACACTGAATGTGCAGCACAACGGATTTTGTGAACGTTGC CACAACGCCCGGCAACTTCACGCCAGCCACGCCCCAGACCACACAAGGCA CTTGGATCCCGGGAAGTGCCAAGCCTGCCTCCAGGATGTTACCAGGACAT TTAATGGGATCTGCAGTACTTGCTTCAAAAGGACTACAGCAGAGGCCTCC TCCAGCCTCAGCACCAGCCTCCCTCCTTCCTGTCACCAGCGTTCCAAGTC AGATCCCTCGCGGCTCGTCCGGAGCCCCTCCCCGCATTCTTGCCACAGAG CTGGAAACGACGtCCCTGCTGGCTGCCTGTCTCAAGCTGCACGGACTCCT GGGGACAGGACGGGGACGAGCAAGTGCAGAAAAGCCGGCTGCGTGTATTT TGGGACTCCAGAAAACAAGGGCTTTTGCACACTGTGTTTCATCGAGTACA GAGAAAACAAACATTTTGCTGCTGCCTCAGGGAAAGTCAGTCCCACAGCG TCCAGGTTCCAGAACACCATTCCGTGCCTGGGGAGGGAATGCGGCACCCT TGGAAGCACCATGTTTGAAGGATACTGCCAGAAGTGTTTCATTGAAGCTC AGAATCAGAGATTTCATGAGGCCAAAAGGACAGAAGAGCAACTGAGATCG AGCCAGCGCAGAGATGTGCCTCGAACCACACAAAGCACCTCAAGGCCCAA GTGCGCCCGGGCCTCCTGCAAGAACATCCTGGCCTGCCGCAGCGAGGAGC TCTGCATGGAGTGTCAGCATCCCAACCAGAGGATGGGCCCTGGGGCCCAC CGGGGTGAGCCTGCCCCCGAAGACCCCCCCAAGCAGCGTTGCCGGGCCCC CGCCTGTGATCATTTTGGCAATGCCAAGTGCAACGGCTACTGCAACGAAT GCTTTCAGTTCAAGCAGATGTATGGCTAAgcggccgc
Amino Acid Sequence:
View Sequence

MDYKDDDDKGSMAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHH FKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREV RKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFK FRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYN SLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWP AQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVH FLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEI NLVDDYFELVQHEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCET PNCPFFMSVNTQPLCHECSERRQKNQNKLPKLNSKPGPEGLPGMALGASR GEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNV QHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTC FKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDVPAG CLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAA ASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEA KRTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHP NQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMY G*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No
Comments:
PARENTAL 51393 puro selection

Do you need any help? Please get in touch and we’ll be happy to lend a hand.