cDNA Clone - ZUFSP

Name: ZUFSP
Price per aliquot: £110.00
Expressed:
MBP-ZUFSP T335-P578
Plasmid:
pMEX ZUFSP T335-P578
Parent Plasmid:
pMEX
View Parent Plasmid

|
DU Number:
DU59287
Genbank:
Sequence of Insert:
View Sequence

GGATCCATGACAGATGTGAGACGGGTGTGGCTTTCTTCAGTGGTGGATCACTTTCATTCATCTTTAGGCGACAAAGGTTGGGGTTGTGGTTACAGAAATTTCCAAATGCTACTTTCATCATTATTACAAAATGATGCTTACAACGATTGCTTAAAAGGTATGTTGATTCCTTGCATTCCAAAAATTCAATCTATGATTGAAGATGCATGGAAGGAAGGTTTTGATCCTCAGGGGGCCTCTCAACTTAATAACAGGTTACAGGGAACAAAGGCCTGGATTGGAGCATGTGAAGTATATATACTCCTGACCTCCCTAAGGGTAAAGTGTCATATTGTTGATTTTCACAAATCAACTGGTCCTTTGGGTACACACCCTCGCTTATTTGAATGGATATTGAACTATTATTCTTCAGAGGGAGAAGGGAGTCCAAAGGTAGTGTGTACATCTAAACCTCCTATCTATCTTCAGCATCAAGGTCACAGTCGAACTGTTATTGGAATTGAAGAGAAAAAAAACCGAACATTATGCTTACTAATACTTGATCCTGGATGTCCTTCTCGAGAAATGCAGAAATTATTAAAGCAAGACATAGAGGCTAGCAGTCTCAAGCAACTTCGGAAATCTATGGGAAATTTAAAACATAAGCAATACCAGATATTGGCAGTAGAGGGTGCTCTTTCTCTAGAGGAGAAACTTGCCAGGAGACAAGCTTCTCAAGTCTTTACAGCCGAGAAGATTCCTTGAGCGGCCG
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMTDVRRVWLSSVVDHFHSSLGDKGWGCGYRNFQMLLSSLLQNDAYNDCLKGMLIPCIPKIQSMIEDAWKEGFDPQGASQLNNRLQGTKAWIGACEVYILLTSLRVKCHIVDFHKSTGPLGTHPRLFEWILNYYSSEGEGSPKVVCTSKPPIYLQHQGHSRTVIGIEEKKNRTLCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEGALSLEEKLARRQASQVFTAEKIP*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No
Comments:
Hi, please can I get MBP-ZUFSP T335-P578. Cheers.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.