cDNA Clone - Rab1b

Name: Rab1b
Price per aliquot: £110.00
Expressed:
HA Rab1b S111A
Plasmid:
pcDNA5 FRT/TO HA Rab1b S111A
Parent Plasmid:
pcDNA5 FRT/TO HA
View Parent Plasmid

|
DU Number:
DU51893
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGAACCCCGAATATGACTACCTGTTTAAGCTGCTTTTGATTGGCGACTCAGGCGTGGGCAAGTCATGCCTGCTCCTGCGGTTTGCTGATGACA CGTACACAGAGAGCTACATCAGCACCATCGGGGTGGACTTCAAGATCCGAACCATCGAGCTGGATGGCAAAACTATCAAACTTCAGATCTGGGACACAGC GGGCCAGGAACGGTTCCGGACCATCACTTCCAGCTACTACCGGGGGGCTCATGGCATCATCGTGGTGTATGACGTCACTGACCAGGAATCCTACGCCAAC GTGAAGCAGTGGCTGCAGGAGATTGACCGCTATGCCGCCGAGAACGTCAATAAGCTCCTGGTGGGCAACAAGAGCGACCTCACCACCAAGAAGGTGGTGG ACAACACCACAGCCAAGGAGTTTGCAGACTCTCTGGGCATCCCCTTCTTGGAGACGAGCGCCAAGAATGCCACCAATGTCGAGCAGGCGTTCATGACCAT GGCTGCTGAAATCAAAAAGCGGATGGGGCCTGGAGCAGCCTCTGGGGGCGAGCGGCCCAATCTCAAGATCGACAGCACCCCTGTAAAGCCGGCTGGCGGT GGCTGTTGCTAGGCGGCCGC
Amino Acid Sequence:
View Sequence

TMYPYDVPDYAGSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVV YDVTDQESYANVKQWLQEIDRYAAENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLK IDSTPVKPAGGGCC*
Antibiotic:
Amp
Comments:
Please clone into pcDNA5D FRT/TO HA vector

Do you need any help? Please get in touch and we’ll be happy to lend a hand.