cDNA Clone - RAB33B

Name: RAB33B
Price per aliquot: £110.00
Expressed:
HA-Rab33b
Plasmid:
pCMV5 HA DU Rab33b
Parent Plasmid:
pCMV5 HA DU
View Parent Plasmid

|
DU Number:
DU28314
Genbank:
Species:
Human
Synonyms:
SMC2
Sequence of Insert:
View Sequence

ggatccATGGCTGAGGAGATGGAGTCGTCGCTCGAGGCAAGCTTTTCGTCCAGCGGGGCAGTGTCAGGGGCCTCAGGGTTTTTGCCTCCTGCCCGCTCCCGCATCTTCAAGATAATCGTGATCGGCGACTCCAATGTGGGCAAGACATGCCTGACCTACCGCTTCTGCGCTGGCCGCTTCCCCGACCGCACCGAGGCCACGATAGGGGTGGATTTCCGAGAACGAGCGGTGGAGATTGATGGGGAGCGCATCAAGATCCAGCTATGGGACACAGCAGGACAAGAACGATTCAGAAAGAGCATGGTTCAGCACTACTACAGAAATGTACATGCTGTTGTCTTCGTGTATGATATGACCAACATGGCTAGTTTTCATAGCCTACCATCTTGGATAGAAGAATGCAAACAACATTTGCTAGCCAATGATATACCACGGATTCTTGTTGGAAATAAATGTGACTTGAGAAGTGCCATACAGGTACCCACAGACTTGGCACAAAAATTTGCTGACACACACAGTATGCCTTTGTTTGAAACGTCTGCTAAAAACCCCAATGATAATGACCATGTGGAAGCTATATTTATGACCTTGGCTCATAAGCTTAAGAGCCACAAACCATTAATGCTTAGTCAGCCCCCTGATAATGGAATTATCCTGAAGCCTGAACCAAAGCCTGCAATGACGTGCTGGTGCTAAgcggccgc
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGSMAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIV IGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVEIDGERIKIQLWD TAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLA NDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHV EAIFMTLAHKLKSHKPLMLSQPPDNGIILKPEPKPAMTCWC*
Antibiotic:
Amp
Comments:
Parental 44059

Do you need any help? Please get in touch and we’ll be happy to lend a hand.