cDNA Clone - Rab12

Name: Rab12
Price per aliquot: £110.00
Expressed:
GST-Rab12
Plasmid:
pcDNA FRT TO GST Rab12
View Parent Plasmid

DU Number:
DU47849
Genbank:
Sequence of Insert:
View Sequence

GGATCCATGGACCCGGGCGCCGCGCTGCAGAGGCGGGCCGGGGGCGGCGGCGGTCTGGGCGCGGGCTCCCCGGCGCTGTCGGGCGGCCAGGGCCGCCGGAGGAAGCAGCCCCCCAGGCCGGCCGACTTCAAGTTGCAGGTCATCATTATCGGCTCCCGCGGCGTGGGCAAGACCAGCCTGATGGAGCGCTTCACCGACGACACCTTCTGCGAGGCCTGCAAGTCCACCGTGGGTGTTGACTTCAAAATCAAAACTGTAGAGCTAAGAGGAAAGAAAATTAGATTACAGATCTGGGACACAGCAGGTCAGGAGAGATTCAACAGCATTACCTCAGCTTATTACAGAAGTGCCAAGGGGATCATATTAGTATATGATATCACTAAGAAGGAGACATTTGATGATTTGCCGAAATGGATGAAGATGATTGATAAGTATGCTTCAGAAGATGCAGAGCTTCTCTTAGTTGGAAATAAGTTGGACTGTGAAACGGACAGAGAAATCACCAGGCAGCAGGGGGAAAAGTTTGCACAGCAGATCACTGGGATGCGGTTCTGTGAAGCAAGTGCCAAGGATAACTTCAATGTGGACGAGATATTTTTGAAACTTGTCGATGACATTCTGAAAAAGATGCCTCTGGATATTTTAAGGAATGAGTTGTCCAATAGTATCCTGTCGTTACAACCAGAGCCTGAGATACCGCCAGAACTGCCTCCACCAAGACCACATGTCCGATGCTGTTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.