cDNA Clone - Rab8 (drosophila)

Name: Rab8 (drosophila)
Price per aliquot: £110.00
Expressed:
Drosophila Rab8 T72E S111E
Plasmid:
pUAST Rab8 (drosophila) T72E S111E
Parent Plasmid:
pUAST
View Parent Plasmid

|
DU Number:
DU51259
Genbank:
Species:
Drosophila Melanogaster
Sequence of Insert:
View Sequence

AGATCCATGGCCAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGG CGATAGCGGCGTGGGCAAGACCTGCATCCTGTTCCGCTTCAGCGAGGATG CCTTCAACACCACCTTCATCAGCACCATCGGCATCGATTTCAAGATCCGC ACCATCGAGCTGGACAACAAGAAGATCAAGCTGCAGATCTGGGATACCGC CGGACAGGAGCGCTTCCGCGAGATTACCACCGCCTACTACCGCGGAGCCA TGGGCATCATGCTGGTGTACGATATCACCCAGGAAAAGTCCTTCGAGAAC ATCAAGAACTGGATTCGCAACATCGAGGAGAACGCCGAAGCCGACGTGGA GAAGATGCTGCTGGGCAACAAGTGCGAGCTGACCGATAAGCGCCAGGTGT CCAAGGAGCGCGGAGAGCAGCTGGCCATCGAGTACGGCATCAAGTTCATG GAGACCAGCGCCAAGGCCAGCATCAACGTGGAGGAGGCCTTTCTGACCCT GGCCAGCGATATCAAGGCCAAGACCGAGAAGCGCATGGAGGCCAACAATC CCCCAAAGGGCGGCCACCAGCTGAAGCCGATGGATAGCCGCACCAAGGAT AGCTGGCTGAGCCGCTGCAGCCTGCTGTAGGCGGCCGC
Amino Acid Sequence:
View Sequence

MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTI ELDNKKIKLQIWDTAGQERFREITTAYYRGAMGIMLVYDITQEKSFENIK NWIRNIEENAEADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMET SAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTKDSW LSRCSLL*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.