cDNA Clone
(mu)IL-33

Synonyms
interleukin 33
Plasmid
pSc-B-(mu)IL-33 Ser109-Ile266
Parent Plasmid
pSC-B
Genbank
NM_133775.3
Species
Mouse
Sequence of Insert
GGATCCAGCATCCAAGGAACTTCACTTTTAACACAGTCTCCTGCCTCCCTGAGTACATACAATGACCAATCTGTTAGTTTTGTTTTGGAGAATGGATGTTATGTGATCAATGTTGACGACTCTGGAAAAGACCAAGAGCAAGACCAGGTGCTACTACGCTACTATGAGTCTCCCTGTCCTGCAAGTCAATCAGGCGACGGTGTGGATGGGAAGAAGCTGATGGTGAACATGAGTCCCATCAAAGACACAGACATCTGGCTGCATGCCAACGACAAGGACTACTCCGTGGAGCTTCAAAGGGGTGACGTCTCGCCTCCGGAACAGGCCTTCTTCGTCCTTCACAAAAAGTCCTCGGACTTTGTTTCATTTGAATGCAAGAATCTTCCTGGCACTTACATAGGAGTAAAAGATAACCAGCTGGCTCTAGTGGAGGAGAAAGATGAGAGCTGCAACAATATTATGTTTAAGCTCTCGAAAATCTAAGCGGCCGC

Amino Acid Sequence
SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLL
RYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGD
VSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNN
IMFKLSKI*
Vector Type
Other
Antibiotic
Amp; Kan
DU Number
DU29477
Location
PPU
MTA
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.