cDNA Clone
(Hu)IL-33

Plasmid
pGEX6P1 sumo-IL-33 Ser112-Thr270
Parent Plasmid
pGEX6P1 sumo
Expressed
GST-sumo-IL-33 Ser112-Thr270
Genbank
NM_033439.3 → NP_254274.1
Tag
GST
SUMO
Species
Human
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLEVLFQGPSDQEAKPSTEDLGDKKEGEYIK
LKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIAD
NHTPKELGMEEEDVIEVYQEQTGGSITGISPITEYLASLSTYNDQSITFA
LEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLS
PTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPG
VFIGVKDNHLALIKVDSSENLCTENILFKLSET*
Vector Type
Bacterial
Antibiotic
Amp
DU Number
DU29529
Location
PPU
MTA
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.