cDNA Clone FAF1-UBX (Human)

• Synonyms: UBXN3A, UBXD12
• Plasmid: pK27SUMO
• Expressed: FAF1-UBX (Human)
• Genbank: NP_008982.1
• Tag: SUMO
• Tag: 10His

Amino Acid Sequence

EPVSKLRIRTPSGEFLERRFLASNKLQIVF
DFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE

• Vector Type: Bacterial
• Antibiotic: Kan
• Full Snapgene Map: pK27SUMO180.36 KB Snapgene files can be opened using software available here: www.snapgene.com
• DU Number: DU73320
• Unit Source: Protein Phosphorylation and Ubiquitylation Unit
• Location: PPU
• MTA: Dundee
• Notes: DU73320. Deposited by Karim Labib group; ; 14His-Smt3-human FAF1-UBX (PCR & Gibson cloning; oligos 9043+7905); ; pRF047
• Low Temp: No