cDNA Clone
53BP1

Synonyms
TP53BP1
Plasmid
pCMV5-HA 53BP1 S380A
Parent Plasmid
pCMV5
Expressed
HA-53BP1 S380A
Genbank
NM_005657
Tag
HA
Species
Human
Sequence of Insert
ggtaccGCCACCATGTACCCATACGATGTGCCAGATTACGCCATGGACCC
TACTGGAAGTCAGTTGGATTCAGATTTCTCTCAGCAAGATACTCCTTGCC
TGATAATTGAAGATTCTCAGCCTGAAAGCCAGGTTCTAGAGGATGATTCT
GGTTCTCACTTCAGTATGCTATCTCGACACCTTCCTAATCTCCAGACGCA
CAAAGAAAATCCTGTGTTGGATGTTGTGTCCAATCCTGAACAAACAGCTG
GAGAAGAACGAGGAGACGGTAATAGTGGGTTCAATGAACATTTGAAAGAA
AACAAGGTTGCAGACCCTGTGGATTCTTCTAACTTGGACACATGTGGTTC
CATCAGTCAGGTCATTGAGCAGTTACCTCAGCCAAACAGGACAAGCAGTG
TTCTGGGAATGTCAGTGGAATCTGCTCCTGCTGTGGAGGAAGAGAAGGGA
GAAGAGTTGGAACAGAAGGAGAAAGAGAAGGAAGAAGATACTTCAGGCAA
TACTACACATTCCCTTGGTGCTGAAGATACTGCCTCATCACAGTTGGGTT
TTGGGGTTCTGGAACTCTCCCAGAGCCAGGATGTTGAGGAAAATACTGTG
CCATATGAAGTGGACAAAGAGCAGCTACAATCAGTAACCACCAACTCTGG
TTATACCAGGCTGTCTGATGTGGATGCTAATACTGCAATTAAGCATGAAG
AACAGTCCAACGAAGATATCCCCATAGCAGAACAGTCCAGCAAGGACATC
CCTGTGACAGCACAGCCCAGTAAGGATGTACATGTTGTAAAAGAGCAAAA
TCCACCACCTGCAAGGTCAGAGGACATGCCTTTTAGCCCCAAAGCATCTG
TTGCTGCTATGGAAGCAAAAGAACAGTTGTCTGCACAAGAACTTATGGAA
AGTGGACTGCAGATTCAGAAGTCACCAGAGCCTGAGGTTTTGTCAACTCA
GGAAGACTTGTTTGACCAGAGCAATAAAACAGTATCTTCTGATGGTTGCT
CTACTCCTTCAAGGGAGGAAGGTGGGTGTTCTTTGGCTTCCACTCCTGCC
ACCACTCTGCATCTCCTGCAGCTCTCTGGTCAGAGGTCCCTTGTTCAGGA
CAGTCTTTCCACGAATTCTTCAGATCTTGTTGCTCCTTCTCCTGATGCTT
TCCGATCTACTCCTTTTATCGTTCCTAGCgcTCCCACAGAGCAAGAAGGG
AGACAAGATAAGCCAATGGACACGTCAGTGTTATCTGAAGAAGGAGGAGA
GCCTTTTCAGAAGAAACTTCAAAGTGGTGAACCAGTGGAGTTAGAAAACC
CCCCTCTCCTGCCTGAGTCCACTGTATCACCACAAGCCTCAACACCAATA
TCTCAGAGCACACCAGTCTTCCCTCCTGGGTCACTTCCTATCCCATCCCA
GCCTCAGTTTTCTCATGACATTTTTATTCCTTCCCCAAGTCTGGAAGAAC
AATCAAATGATGGGAAGAAAGATGGAGATATGCATAGTTCATCTTTGACA
GTTGAGTGTTCTAAAACTTCAGAGATTGAACCAAAGAATTCCCCTGAGGA
TCTTGGGCTATCTTTGACAGGGGATTCTTGCAAGTTGATGCTTTCTACAA
GTGAATATAGTCAGTCCCCAAAGATGGAGAGCTTGAGTTCTCACAGAATT
GATGAAGATGGAGAAAACACACAGATTGAGGATACGGAACCCATGTCTCC
AGTTCTCAATTCTAAATTTGTTCCTGCTGAAAATGATAGTATCCTGATGA
ATCCAGCACAGGATGGTGAAGTACAACTGAGTCAGAATGATGACAAAACA
AAGGGAGATGATACAGACACCAGGGATGACATTAGTATTTTAGCCACTGG
TTGCAAGGGCAGAGAAGAAACGGTAGCAGAAGATGTTTGTATTGATCTCA
CTTGTGATTCGGGGAGTCAGGCAGTTCCGTCACCAGCTACTCGATCTGAG
GCACTTTCTAGTGTGTTAGATCAGGAGGAAGCTATGGAAATTAAAGAACA
CCATCCAGAGGAGGGGTCTTCAGGGTCTGAGGTGGAAGAAATCCCTGAGA
CACCTTGTGAAAGTCAAGGAGAGGAACTCAAAGAAGAAAATATGGAGAGT
GTTCCGTTGCACCTTTCTCTGACTGAAACTCAGTCCCAAGGGTTGTGTCT
TCAAAAGGAAATGCCAAAAAAAGAATGCTCAGAAGCTATGGAAGTTGAAA
CCAGTGTGATTAGTATTGATTCCCCTCAAAAGTTGGCAATACTTGACCAA
GAATTGGAACATAAGGAACAGGAAGCTTGGGAAGAAGCTACTTCAGAGGA
CTCCAGTGTTGTCATTGTAGATGTGAAAGAGCCATCTCCCAGAGTTGATG
TTTCTTGTGAACCTTTGGAGGGAGTGGAGAAGTGCTCAGATTCCCAGTCA
TGGGAGGATATTGCTCCAGAAATAGAACCATGTGCTGAGAATAGATTAGA
CACCAAGGAAGAAAAGAGTGTAGAATATGAAGGAGATCTGAAATCAGGGA
CTGCAGAAACAGAACCTGTAGAGCAAGATTCTTCACAGCCTTCCTTACCT
TTAGTGAGAGCAGATGATCCTTTAAGACTTGACCAGGAGTTGCAGCAGCC
CCAAACTCAGGAGAAAACAAGTAATTCATTAACAGAAGACTCAAAAATGG
CTAATGCAAAGCAGCTAAGCTCAGATGCAGAGGCCCAGAAGCTGGGGAAG
CCCTCTGCCCATGCCTCACAAAGCTTCTGTGAAAGTTCTAGTGAAACCCC
ATTTCATTTCACTTTGCCTAAAGAAGGTGATATCATCCCACCATTGACTG
GTGCAACCCCACCTCTTATTGGGCACCTAAAATTGGAGCCCAAGAGACAC
AGTACTCCTATTGGTATTAGCAACTATCCAGAAAGCACCATAGCAACCAG
TGATGTCATGTCTGAAAGCATGGTGGAGACCCATGATCCCATACTTGGGA
GTGGAAAAGGGGATTCTGGGGCTGCCCCAGACGTGGATGATAAATTATGT
CTAAGAATGAAACTGGTTAGTCCTGAGACTGAGGCGAGTGAAGAGTCTTT
GCAGTTCAACCTGGAAAAGCCTGCAACTGGTGAAAGAAAAAATGGATCTA
CTGCTGTTGCTGAGTCTGTTGCCAGTCCCCAGAAGACCATGTCTGTGTTG
AGCTGTATCTGTGAAGCCAGGCAAGAGAATGAGGCTCGAAGTGAGGATCC
CCCCACCACACCCATCAGGGGGAACTTGCTCCACTTTCCAAGTTCTCAAG
GAGAAGAGGAGAAAGAAAAATTGGAGGGTGACCATACAATCAGGCAGAGT
CAACAGCCTATGAAGCCCATTAGTCCTGTCAAGGACCCTGTTTCTCCTGC
TTCCCAGAAGATGGTCATACAAGGGCCATCCAGTCCTCAAGGAGAGGCAA
TGGTGACAGATGTGCTAGAAGACCAGAAAGAAGGACGGAGTACTAATAAG
GAAAATCCTAGTAAGGCCTTGATTGAAAGGCCCAGCCAAAATAACATAGG
AATCCAAACCATGGAGTGTTCCTTGAGGGTCCCAGAAACTGTTTCAGCAG
CAACCCAGACTATAAAGAATGTGTGTGAGCAGGGGACCAGTACAGTGGAC
CAGAACTTTGGAAAGCAAGATGCCACAGTTCAGACTGAGAGGGGGAGTGG
TGAGAAACCAGTCAGTGCTCCTGGGGATGATACAGAGTCGCTCCATAGCC
AGGGAGAAGAAGAGTTTGATATGCCTCAGCCTCCACATGGCCATGTCTTA
CATCGTCACATGAGAACAATCCGGGAAGTACGCACACTTGTCACTCGTGT
CATTACAGATGTGTATTATGTGGATGGAACAGAAGTAGAAAGAAAAGTAA
CTGAGGAGACTGAAGAGCCAATTGTAGAGTGTCAGGAGTGTGAAACTGAA
GTTTCCCCTTCACAGACTGGGGGCTCCTCAGGTGACCTGGGGGATATCAG
CTCCTTCTCCTCCAAGGCATCCAGCTTACACCGCACATCAAGTGGGACAA
GTCTCTCAGCTATGCACAGCAGTGGAAGCTCAGGGAAAGGAGCCGGACCA
CTCAGAGGGAAAACCAGCGGGACAGAACCCGCAGATTTTGCCTTACCCAG
CTCCCGAGGAGGCCCAGGAAAACTGAGTCCTAGAAAAGGGGTCAGTCAGA
CAGGGACGCCAGTGTGTGAGGAGGATGGTGATGCAGGCCTTGGCATCAGA
CAGGGAGGGAAGGCTCCAGTCACGCCTCGTGGGCGTGGGCGAAGGGGCCG
CCCACCTTCTCGGACCACTGGAACCAGAGAAACAGCTGTGCCTGGCCCCT
TGGGCATAGAGGACATTTCACCTAACTTGTCACCAGATGATAAATCCTTC
AGCCGTGTCGTGCCCCGAGTGCCAGACTCCACCAGACGAACAGATGTGGG
TGCTGGTGCTTTGCGTCGTAGTGACTCTCCAGAAATTCCTTTCCAGGCTG
CTGCTGGCCCTTCTGATGGCTTAGATGCCTCCTCTCCAGGAAATAGCTTT
GTAGGGCTCCGTGTTGTAGCCAAGTGGTCATCCAATGGCTACTTTTACTC
TGGGAAAATCACACGAGATGTCGGAGCTGGGAAGTATAAATTGCTCTTTG
ATGATGGGTACGAATGTGATGTGTTGGGCAAAGACATTCTGTTATGTGAC
CCCATCCCGCTGGACACTGAAGTGACGGCCCTCTCGGAGGATGAGTATTT
CAGTGCAGGAGTGGTGAAAGGACATAGGAAGGAGTCTGGGGAACTGTACT
ACAGCATTGAAAAAGAAGGCCAAAGAAAGTGGTATAAGCGAATGGCTGTC
ATCCTGTCCTTGGAGCAAGGAAACAGACTGAGAGAGCAGTATGGGCTTGG
CCCCTATGAAGCAGTAACACCTCTTACAAAGGCAGCAGATATCAGCTTAG
ACAATTTGGTGGAAGGGAAGCGGAAACGGCGCAGTAACGTCAGCTCCCCA
GCCACCCCTACTGCCTCCAGTAGCAGCAGCACAACCCCTACCCGAAAGAT
CACAGAAAGTCCTCGTGCCTCCATGGGAGTTCTCTCAGGCAAAAGAAAAC
TTATCACTTCTGAAGAGGAACGGTCCCCTGCCAAGCGAGGTCGCAAGTCT
GCCACAGTAAAACCTGGTGCAGTAGGGGCAGGAGAGTTTGTGAGCCCCTG
TGAGAGTGGAGACAACACCGGTGAACCCTCTGCCCTGGAAGAGCAGAGAG
GGCCTTTGCCTCTCAACAAGACCTTGTTTCTGGGCTACGCATTTCTCCTT
ACCATGGCCACAACCAGTGACAAGTTGGCCAGCCGCTCCAAACTGCCAGA
TGGTCCTACAGGAAGCAGTGAAGAAGAGGAGGAATTTTTGGAAATTCCTC
CTTTCAACAAGCAGTATACAGAATCCCAGCTTCGAGCAGGAGCTGGCTAT
ATCCTTGAAGATTTCAATGAAGCCCAGTGTAACACAGCTTACCAGTGTCT
TCTAATTGCGGATCAGCATTGTCGAACCCGGAAGTACTTCCTGTGCCTTG
CCAGTGGGATTCCTTGTGTGTCTCATGTCTGGGTCCATGATAGTTGCCAT
GCCAACCAGCTCCAGAACTACCGTAATTATCTGTTGCCAGCTGGGTACAG
CCTTGAGGAGCAAAGAATTCTGGACTGGCAACCCCGTGAAAATCCTTTCC
AGAATCTGAAGGTACTCTTGGTATCAGACCAACAGCAGAACTTCCTGGAG
CTCTGGTCTGAGATCCTCATGACTGGTGGTGCAGCCTCTGTGAAGCAGCA
CCATTCAAGTGCCCATAACAAAGATATTGCTTTAGGGGTATTTGATGTGG
TGGTGACGGACCCCTCATGCCCAGCCTCGGTGCTGAAGTGTGCTGAAGCA
TTGCAGCTGCCTGTGGTGTCACAAGAGTGGGTGATCCAGTGCCTCATTGT
TGGGGAGAGAATTGGATTCAAGCAGCATCCAAAATATAAACACGATTATG
TTTCTCACTAAgtcgac
Amino Acid Sequence
MYPYDVPDYAMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHF
SMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVA
DPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELE
QKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQDVEENTVPYEV
DKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTA
QPSKDVHVVKEQNPPPARSEDMPFSPKASVAAMEAKEQLSAQELMESGLQ
IQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLH
LLQLSGQRSLVQDSLSTNSSDLVAPSPDAFRSTPFIVPSAPTEQEGRQDK
PMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQST
PVFPPGSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECS
KTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDG
ENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDD
TDTRDDISILATGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEALSS
VLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLH
LSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLAILDQELEH
KEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDI
APEIEPCAENRLDTKEEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRA
DDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAH
ASQSFCESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPI
GISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCLRMK
LVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCIC
EARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGDHTIRQSQQPM
KPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPS
KALIERPSQNNIGIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQNFG
KQDATVQTERGSGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRHM
RTIREVRTLVTRVITDVYYVDGTEVERKVTEETEEPIVECQECETEVSPS
QTGGSSGDLGDISSFSSKASSLHRTSSGTSLSAMHSSGSSGKGAGPLRGK
TSGTEPADFALPSSRGGPGKLSPRKGVSQTGTPVCEEDGDAGLGIRQGGK
APVTPRGRGRRGRPPSRTTGTRETAVPGPLGIEDISPNLSPDDKSFSRVV
PRVPDSTRRTDVGAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLR
VVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPL
DTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSL
EQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSNVSSPATPT
ASSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPAKRGRKSATVK
PGAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMAT
TSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILED
FNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQL
QNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSE
ILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLP
VVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH*
Vector Type
Mammalian
Antibiotic
Amp
Full Snapgene Map
pCMV5-HA 53BP1 S380A62.65 KBSnapgene files can be opened using software available here: www.snapgene.com
DU Number
DU5881
Location
PPU
MTA
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.