Antibodies

Title Full Name Immuno Sequence Mono/Poly clonal Sheep Number Aliquot Price Add to cart
PTPL1 PTPL1 (2060 - 2450) GST-PTPL1 (2060 - 2450 of mouse) Polyclonal S057C 0.1mg
£125.00
PTPL1 PTPL1 PDZ2 GST-PTPL1 [residues 1371 - 1467] Polyclonal S216B 0.1mg
£125.00
QIK   QIK (906 - 926) LFDCEMLDAVDPQHNGYVLVN [residues 906 - 926 of human] Polyclonal S228B 0.1mg
£125.00
QIK   QIK (906 - 926) LFDCEMLDAVDPQHNGYVLVN [residues 906 - 926 of human] Polyclonal S236C 0.1mg
£125.00
QIK   QIK (1 - 21) MVMADGPRHLQRGPVRVGFYD [residues 1 - 21 of human] Polyclonal S236C 0.1mg
£125.00
QIK   QIK (1 - 21) MVMADGPRHLQRGPVRVGFYD [residues 1 - 21 of human] Polyclonal S228B 0.1mg
£125.00
QSK   SIK3 (1349 - 1369) TDILLSYKHPEVSFSMEQAGV [residues 1349 - 1369 of human] Polyclonal S226B 0.1mg
£125.00
RAB10 RAB10 (1 - 200) His-RAB10 (1 - 200) [DU 51004] Polyclonal SA146 0.1mg
£125.00
RAB10 RAB10 (131 - 155) CTPVKEPNSENVDISSGGGVTGWKSK [residues 131 - 155 of human] Polyclonal S945D 0.1mg
£125.00
RAB10 RAB10 phospho Thr 73 AGQERFHT*ITTSYYR [residues 66 - 80 of human] Polyclonal S873D 0.1mg
£125.00
RAB12 RAB12 RAB12 [DU 52221] Polyclonal SA227 0.1mg
£125.00
RAB12 RAB12 (71 - 103) CKSTVGVDFKIKTVELRGKKIRLQIWDTAGQER [residues 71 - 103 of human] Polyclonal SA100 0.1mg
£125.00
RAB12 RAB12 phospho Ser 106 AGQERFNS*ITSAYYR [residues 99 - 113] Polyclonal S876D 0.1mg
£125.00
Rab13 Rab13 MBP-Rab13 [Du 43886] Polyclonal S806D 0.1mg
£125.00
Rab13   Rab13 phospho Ser 111 KSIKENAS*AGVERLR [residues 104 - 117 of human] Polyclonal S505D 0.1mg
£125.00
RAB1A RAB1A phospho Ser 114 CQEIDRYAS*ENVNKLR [residues 107 - 120 of human] Polyclonal S817D 0.1mg
£125.00
RAB1B RAB1B phospho Ser 111 CQEIDRYAS*ENVNKLR [residues 104 - 118 of human] Polyclonal S817D 0.1mg
£125.00
RAB35 RAB35 GST-RAB35 [DU 26867] Polyclonal SA314 0.1mg
£125.00
RAB35 RAB35 (114 - 144) CRILVGNKNDDPERKVVETEDAYKFAGQMGI [residues 114 - 144 of human] Polyclonal SA101 0.1mg
£125.00
Rab35 RAB35 phospho Thr 72 AGQERFRT*ITSTYYR [residues 65 - 79 of human] Polyclonal SA083 0.1mg
£125.00