cDNA Clone - (mu) MYCBP2

Name: (mu) MYCBP2
Price per aliquot: £125.00
Expressed:
Mouse Mycbp2
Plasmid:
pSc-B-(mu)MYCBP2 nt10107-end
Parental Plasmid:
pSC-B
View Parent Plasmid

Snapgene File | Genbank File
ATGACCATGATTACGCCAAGCGCGCAATTAACCCTCACTAAAGGGAACAAAAGCTGGGTACCGGGCCCCCCCTCGAGGTCGACGGTATCGATAAGCTTGATATCCACTGTGGAATTCGCCCTTAAGGGCGAATTCCACATTGGTCGCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCACCGCGGGAGCTCCAATTCGCCCTATAGTGAGTCGTATTACGCGCGCTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATTAAATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAGTCAGAAGAACTCGTCAAGAAGGCGATAGAAGGCGATGCGCTGCGAATCGGGAGCGGCGATACCGTAAAGCACGAGGAAGCGGTCAGCCCATTCGCCGCCAAGTTCTTCAGCAATATCACGGGTAGCCAACGCTATGTCCTGATAGCGGTCCGCCACACCCAGCCGGCCACAGTCGATGAATCCAGAAAAGCGGCCATTTTCCACCATGATATTCGGCAAGCAGGCATCGCCATGGGTCACGACGAGATCCTCGCCGTCGGGCATGCTCGCCTTGAGCCTGGCGAACAGTTCGGCTGGCGCGAGCCCCTGATGTTCTTCGTCCAGATCATCCTGATCGACAAGACCGGCTTCCATCCGAGTACGTGCTCGCTCGATGCGATGTTTCGCTTGGTGGTCGAATGGGCAGGTAGCCGGATCAAGCGTATGCAGCCGCCGCATTGCATCAGCCATGATGGATACTTTCTCGGCAGGAGCAAGGTGAGATGACAGGAGATCCTGCCCCGGCACTTCGCCCAATAGCAGCCAGTCCCTTCCCGCTTCAGTGACAACGTCGAGCACAGCTGCGCAAGGAACGCCCGTCGTGGCCAGCCACGATAGCCGCGCTGCCTCGTCTTGCAGTTCATTCAGGGCACCGGACAGGTCGGTCTTGACAAAAAGAACCGGGCGCCCCTGCGCTGACAGCCGGAACACGGCGGCATCAGAGCAGCCGATTGTCTGTTGTGCCCAGTCATAGCCGAATAGCCTCTCCACCCAAGCGGCCGGAGAACCTGCGTGCAATCCATCTTGTTCAATCATTAGTGTCCTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTTAATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGGACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGTCTATTCTTTTGATTTACAGTTAATTAAAGGGAACAAAAGCTGGCATGTACCGTTCGTATAGCATACATTATACGAACGGTACGCTCCAATTCGCCCTTTAATTAACTGTTCCAACTTTCACCATAATGAAATAAGATCACTACCGGGCGTATTTTTTGAGTTGTCGAGATTTTCAGGAGCTAAGGAAGCTAAAATGGAGAAAAAAATCACTGGATATACCACCGAGTACTGCGATGAGTGGCAGGGCGGGGCGTAATTTTTTTAAGGCAGTTATTGGTGCCCTTAAACGCCTGGTTGCTACGCCTGAATAAGTGATAATAAGCGGATGAATGGCAGAAATTCGAAAGCAAATTCGACCCGGTCGTCGGTTCAGGGCAGGGTCGTTAAATAGCCGCTTATGTCTATTGCTGGTTTACCGGTTTATTGACTACCGGAAGCAGTGTGACCGTGTGCTTCTCAAATGCCTGAGGCCAGTTTGCTCAGGCTCTCCCCGTGGAGGTAATAATTGACGATATGATCCTTTTTTTCTGATCAAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTTCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTCCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCT
DU Number:
DU65486
Species:
Mouse
Sequence of Insert:
View Sequence

GGTACCTCGTATGCGATCGCTGTAGAGAAAAATACCTCCGTGAAAAACAG GCCGCTGCAAGGGAAAAGGTCAAACAATCTAGAAGAAAGCCAATGCAAGT AAAGACGCCTCGTGCCTTGCCCACCATGGAAGCACACCAGGTGATCAAAG CCAACGCCCTCTTCCTGCTGTCCCTGAGCAGTGCTGCAGAGCCAAGCATC TTGTGTTACCACCCTGCAAAGCCATTCCAGTCTCAGCTGCCCATCGTGAA GGAAGGCGTTTCTGAGGACCTTCCTGTAAAAATGCCTTGTCTCTACTTGC AGACATTAGCTAGGCACCACCATGAAAATTTTGTGGGCTATCAAGACGAC AACCTATTCCAGGACGAAATGAGATATCTGCGTTCTACATCTGTCCCTGC CCCATACATATCAGTAACTCCTGATGCAAGTCCCAATGTATTTGAAGAGC CAGAGAGCAATATGAAGTCTATGCCACCAAGTTTGGAAACTAGCCCCATA ACCGACACTGACCTGGCTAAGAGAACTGTCTTCCAAAGGTCATACTCAGT TGTTGCTTCTGAGTATGATAAACAACATTCCATTTTACCTGCACGAGTTA AAGCCATCCCTAGAAGAAGAGTGAACAGTGGAGACACTGAAGTTGGGTCT TCCCTCTTGCGACATCCATCGCCAGAGCTTTCCCGGCTCATATCAGCCCA CAGCTCTCTTTCCAAAGGAGAACGGAACTTCCAGTGGCCAGTTTTAGCTT TTGTTATACAGCATCATGATTTAGAAGGGCTTGAAATAGCAATGAAGCAG GCCTTAAGGAAGTCTGCTTGCCGTGTGTTTGCAATGGAGGCATTCAACTG GCTTCTCTGTAATGTCATCCAAACAACATCTCTGCATGACATTCTCTGGC ACTTTGTGGCTGCACTGACGCCTTCTCCCGTAGAAGCAGAGGAAGATGAG GATGAAGATAATAAATCCAATAAAGAAAATGCAGAGCAAGAGAAGGATAC AAGAGTGTGTGAGCATCCACTGTCAGATATAGTGATTGCAGGCGAAGCTG CTCACCCACTGCCACATACGTTTCACCGGTTACTTCAGACCATCTCTGAC CTTATGATGTCCCTCCCTAGTGGCAGTTCATTGCAACAAATGGCCTTAAG ATGCTGGAGCCTCAAGTTCAAGCAGTCCGATCACCAGTTCCTCCATCAGA GCAATGTCTTCCATCACATCAACAACATCTTGTCGAAGTCAGACGATGGA GACAGTGAGGAGAGCTTCAGCATCAGCGTCCAGTCTGGCTTTGAAGCTAT GAGCCAGGAATTATGCATAGTTATGTGCCTAAAGGACTTGACTAGCATCG TTGACATAAAAACATCAAGTCGACCCGCCATGATTGGCAGTTTGACAGAT GGCTCCACAGAAACCTTTTGGGAATCAGGAGATGAAGATAAAAACAAAAC TAAAAATATCACTATCAACTGTGTGAAGGGAATTAATGCCCGTTATGTAT CTGTTCATGTGGACAACTCCCGGGATCTGGGGAATAAAGTTACCTCAATG ACCTTCTTAACTGGGAAAGCAGTAGAAGAGCTGTGCAGAATAAAGCAGGT CGATTTGGATTCCAGGCACATTGGCTGGGTCACAAGTGAACTCCCAGGAG GGGATAATCAGATCATCAAAATAGAGTTAAAGGGCCCAGAAAATACATTA AGAGTTCGACAAGTAAAAGTCCTGGGTTGGAAAGATGGTGAAAGCACAAA AATCGCTGGCCAGATCTCAGCCAGTGTGGCTCAGCAAAGGAGCTGTGAGG CTGAGACTCTCCGAGTGTTCAGACTCATCACCTCTCAAGTGTTTGGAAAG CTCATCTCTGGAGACGCTGAACCCACACCAGAGCAAGAGGAAAAGGCGCT CCTGTCCTCCCCTGAAGGAGAAGAAAAAGTATACAATGCGACATCTGATG CTGACCTGAAGGAACACATGGTTGGAATCATATTCAGCAGGAGTAAACTG ACTAACCTACAAAAGCAGGTGTGTGCACACATCGTCCAAGCTATTCGCAT GGAAGCCACAAGAGTCCGGGAAGAATGGGAACACGCCATATCCAGCAAGG AGAACGCGAACTCCCAGCCCAGTGATGAGGACGCCTCCTCTGACGCTTAC TGCTTCGAGCTGCTCTCTATGGTCCTAGCGCTGAGCGGCTCCAACGTTGG CAGACAGTACCTGGCCCAGCAGCTGACTCTGCTGCAGGACCTGTTCTCCT TGCTCCACACAGCCTCCCCGAGGGTGCAGAGACAGGTGACCTCCTTACTA AGGCGAGTTTTGCCTGAAGTGACTCCTAACCGTCTGGCCAGTATCATCGG AGTGAAGTCCCTCCCCCCAGCTGACATCAGTGACATCATTCACTCAACTG AGAAAGGAGACTGGAATAAGCTGGGTATCTTGGACATGTTTCTGGGATGC ATTGCCAAGGCGCTCACTGTCCAGCTCAAAGCCAAAGGGACCACCATCAC TGGGACAGCCGGCACCACTGTGGGCAAAGGAGTTACAACAGTCACCCTGC CAATGATTTTCAACTCCAGTTACCTCCGACGAGGTGAGAGTCACTGGTGG ATGAAGGGCTCAACTCCTACTCAGATCTCAGAGATCATCATCAGGCTTAT CAAGGATATGGCTGCAGGTCACCTGTCAGAAGCTTGGTCCCGAGTGACAA AAAATGCTATTGCAGAAACCATCATTGCCTTGACCAAAATGGAAGAAGAA TTTAGGTCTCCAGTGAGATGTATTGCAACAACTAGACTCTGGCTTGCCCT GGCATCGCTGTGTGTTCTTGATCAGGACCATGTGGACCGCCTCTCCTCGG GGAGATGGATGGGAAAGGACGGGCAACAGAAGCAAATGCCTATGTGTGAC AACCATGATGACGGTGAAACTGCAGCTATCATCTTATGCAACATCTGTGG CAATCTGTGTACTGACTGTGACAGATTCCTTCATCTGCATCGACGAACGA AGACTCACCAAAGACAGGTCTTCAAAGAAGAAGAAGAGGCTATAAAGGTC GACCTCCATGAAGGCTGTGGTAGAACAAAACTGTTCTGGTTGATGGCATT AGCAGATTCTAAAACAATGAAGGCAATGGTGGAATTCCGAGAACACACAG GCAAACCCACCACGAGTAGCTCGGAAGCATGCCGCTTCTGTGGGTCCAGG AGTGGAACGGAGCTGTCTGCTGTTGGCAGTGTTTGTTCTGATGCAGACTG CCAGGAATATGCTAAGATCGCCTGCAGTAAGACACATCCCTGCGGACATC CGTGTGGAGGTGTTAGAAACGAAGAGCACTGCCTGCCCTGCCTGCACGGC TGTGATAAGAGCGCCACCACACTGAAACAAGATGCCGACGACATGTGCAT GATCTGCTTCACCGAAGCGCTCTCTGCAGCACCGGCCATTCAGTTGGACT GCAGTCATGTGTTCCACTTACAGTGCTGTCGGCGAGTTTTGGAAAACAGA TGGCTTGGTCCAAGGATAACGTTTGGATTCATTTCGTGTCCTATTTGCAA GAACAAGATAAATCATATAGTATTAAAAGACCTGCTTGATCCAATAAAAG AGCTCTATGAAGACGTCAGAAGAAAAGCCTTAATGAGATTGGAGTATGAA GGTCTGCATAAGAGTGAAGCTATCACGACTCCTGGTGTCAGGTTTTATAA TGATGCAGCTGGCTATGCCATGAATAGATACGCATATTATGTCTGCTACA AGTGCAGAAAGGCATACTTTGGTGGTGAGGCTCGCTGTGATGCTGAGGCT GGACAAGGAGATGATTACGACCCCAGAGAGCTCATCTGCGGCGCCTGTTC CGATGTGTCCAGGGCCCAGATGTGTCCCAAACATGGAACAGACTTTCTAG AATACAAGTGTCGCTACTGCTGTTCGGTGGCTGTCTTCTTCTGTTTCGGA ACAACACATTTCTGTAATGCTTGTCATGATGACTTTCAGAGAATGACCAG CATTCCTAAGGAAGAACTCCCACACTGTCCTGCAGGTCCCAAAGGCAAGC AGCTAGAAGGAACTGAGTGTCCACTCCACGTTGTTCATCCGCCCACGGGG GAAGAGTTTGCTCTCGGGTGCGGCGTGTGCAGAAATGCTCACACGTTTTA Ggcggccgc
Amino Acid Sequence:
View Sequence

YLVCDRCREKYLREKQAAAREKVKQSRRKPMQVKTPRALPTMEAHQVIKA NALFLLSLSSAAEPSILCYHPAKPFQSQLPIVKEGVSEDLPVKMPCLYLQ TLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEP ESNMKSMPPSLETSPITDTDLAKRTVFQRSYSVVASEYDKQHSILPARVK AIPRRRVNSGDTEVGSSLLRHPSPELSRLISAHSSLSKGERNFQWPVLAF VIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWH FVAALTPSPVEAEEDEDEDNKSNKENAEQEKDTRVCEHPLSDIVIAGEAA HPLPHTFHRLLQTISDLMMSLPSGSSLQQMALRCWSLKFKQSDHQFLHQS NVFHHINNILSKSDDGDSEESFSISVQSGFEAMSQELCIVMCLKDLTSIV DIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITINCVKGINARYVS VHVDNSRDLGNKVTSMTFLTGKAVEELCRIKQVDLDSRHIGWVTSELPGG DNQIIKIELKGPENTLRVRQVKVLGWKDGESTKIAGQISASVAQQRSCEA ETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKVYNATSDA DLKEHMVGIIFSRSKLTNLQKQVCAHIVQAIRMEATRVREEWEHAISSKE NANSQPSDEDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSL LHTASPRVQRQVTSLLRRVLPEVTPNRLASIIGVKSLPPADISDIIHSTE KGDWNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLP MIFNSSYLRRGESHWWMKGSTPTQISEIIIRLIKDMAAGHLSEAWSRVTK NAIAETIIALTKMEEEFRSPVRCIATTRLWLALASLCVLDQDHVDRLSSG RWMGKDGQQKQMPMCDNHDDGETAAIILCNICGNLCTDCDRFLHLHRRTK THQRQVFKEEEEAIKVDLHEGCGRTKLFWLMALADSKTMKAMVEFREHTG KPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACSKTHPCGHP CGGVRNEEHCLPCLHGCDKSATTLKQDADDMCMICFTEALSAAPAIQLDC SHVFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKE LYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDAAGYAMNRYAYYVCYK CRKAYFGGEARCDAEAGQGDDYDPRELICGACSDVSRAQMCPKHGTDFLE YKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQ LEGTECPLHVVHPPTGEEFALGCGVCRNAHTF*
Bacterial Selection:
Amp, Kan
Low Growth Temperature Requirement?:
No
Comments:
From native Kpn1 site at nt10,107 to end (incl. stop & Not1 site ) comprises Tyr3369-Phe4746 (end) of full-length protein. Clone contains a single residue (Glu) insertion between T3580 and V3581 and a triple residue insertion (Val-Tyr-Asn) between K4009 and Ala4010 compared to NCBI reference

Do you need any help? Please get in touch and we’ll be happy to lend a hand.