cDNA Clone - Rab10

Name: Rab10
Price per aliquot: £125.00
Expressed:
anti-Rab10-pT73(22-5) rIgG LC
Plasmid:
pFUSEss CLIg rK1 anti Rab10 pT73 (22-5) Light chain
Parental Plasmid:
pFUSEss CLIg rK1
View Parent Plasmid

|
DU Number:
DU68351
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

ATGTACAGGATGCAACTCCTGTCTTGCATTGCACTAAGTCTTGCACTTGTCACGAATTCGCAGGTGCTGACCCAGACCCCCAGCAGCACCAGCGCCGCCGTGGGCGGCACCGTGACCATCAACTGCCAGAGCAGCGAGAGCGTGGACAGCAACAACAGGCTGAGCTGGTACCAGGAGAAGCCCGGCCAGCCCCCCAAGCTGCTGATCTACAGGGCCAGCACCCTGGCCAGCGGCGTGCCCAGCAGGTTCAGCGCCAGCGGCAGCGGCACCCAGTTCACCCTGACCATCAGCGACGTGCAGTGCGACGACGCCACCACCTACTACTGCGCCGCCAGGTACATCAGCAACATCGTGGTGTTCGGCGGCGGCACCGAGGTGGTGGTGAAGGATCCAGTTGCACCTACTGTCCTCATCTTCCCACCAGCTGCTGATCAGGTGGCAACTGGAACAGTCACCATCGTGTGTGTGGCGAATAAATACTTTCCCGATGTCACCGTCACCTGGGAGGTGGATGGCACCACCCAAACAACTGGCATCGAGAACAGTAAAACACCGCAGAACTCTGCAGATTGTACCTACAACCTCAGCAGCACTCTGACACTGACCAGCACACAGTACAACAGCCACAAAGAGTACACCTGCAAGGTGACCCAGGGCACGACCTCAGTCGTCCAGAGCTTCAACAGGGGTGACTGCTAG
Amino Acid Sequence:
View Sequence

MYRMQLLSCIALSLALVTNSQVLTQTPSSTSAAVGGTVTINCQSSESVDSNNRLSWYQEKPGQPPKLLIYRASTLASGVPSRFSASGSGTQFTLTISDVQCDDATTYYCAARYISNIVVFGGGTEVVVKDPVAPTVLIFPPAADQVATGTVTIVCVANKYFPDVTVTWEVDGTTQTTGIENSKTPQNSADCTYNLSSTLTLTSTQYNSHKEYTCKVTQGTTSVVQSFNRGDC*
Bacterial Selection:
Blasticidin
Low Growth Temperature Requirement?:
No

Do you need any help? Please get in touch and we’ll be happy to lend a hand.