cDNA Clone
(mu)FAM83H

Plasmid
pcDNA5D-FRT/TO GFP-(mu)Fam83H
Parent Plasmid
pcDNA5D-FRT/TO GFP
Expressed
GFP-(mu)Fam83H
Tag
GFP
Species
Mouse
Sequence of Insert
agatctATGGCCCGTCGCTCCCAGAGCAGCTCGCAGGGGGACAACCCACT
GGCACCTGGGTACCTGCCACCTCACTACAAAGAATATTACCGCCTAGCGG
TGGATGCATTGACTGAGGGTGGGCCAGAAGCCTACAACCGCTTCTTGGCA
TCTGAGGGGGCACCTGACTTCCTGTGCCCTGAGGAACTGGAACACGTGAG
CCGCCACCTGCAGCCCCCACAGTATGTGGCCCGGGAACCCCCTGAAGGCA
CCCCATCTGATGTGGACATGGACGGGTCCTCAGGCACCTACTGGCCAGTG
AACTCAGACCAGGCTGTGCCTGAGCTGGACCTGGGCTGGCCCCTCACATT
TGGCTTCCAAGGCACAGAGGTCACCACACTGGTACAGCCGCCGCCACCTG
ACAGCCCCAGCATCAAAGATGAAGCTCGGAGGATGATCCGCTCTGCCCAG
CAGGTGGTAGCTGTGGTGATGGACATGTTTACCGACGTGGATCTGCTCAG
TGAGGTGCTAGAGGCCGCTGCAAGGCGAGTCCCGGTCTACATTCTGCTGG
ATGAAATGAACGCCCAGCACTTCCTAGACATGGCCGACAAGTGTCGCGTC
AACCTGCATCATGTGGACTTCCTGCGTGTGCGCACAGTGGCAGGTCCTAC
TTACTACTGCCGCACTGGGAAGTCTTTCAAGGGCCATCTAAAGGAGAAGT
TCTTGCTTGTGGACTGTGCCGTAGTGATGAGCGGCAGTTATAGCTTCATG
TGGTCCTTCGAGAAAATCCACCGCAGCCTGGCTCATGTGTTCCAGGGAGA
GTTGGTCTCCAGCTTCGACGAAGAGTTCCGCATCCTCTTCGCACAGTCGG
AGCCACTGGTGCCCTCAGCCGGGGCGCTAGCCCGCATGGATGCCTATGCG
CTAGCTCCATACTCTGGGGCTGGGCCCCTGGTGGGCGTCCCCGGGGTTGG
AGCACCAACACCTTTTTCTTTCCCTAAACGGGCGCACCTCCTATTCCCAC
CGCCCAGGGAAGAAGGCCTGGGCTTCCCCTCTTTCCTAGACCCTGACCGC
CACTTCCTGTCGGCTTTCCGCCGAGAGGAGCTGCAGAGAATGCCTGGGGG
TGCTTTGGAGCCTCACACAGGGCTCCGGCCACTGGCGCGCCCAACTGAGG
CTGGGCCGTTCGGAGAGCTCGCGGGCCCCCGGGGCTTCTTCCAGTCAAGG
CACCTGGAAATGGATGCCTTCAAGCGGCATAGCTACGCAACACCCGATGG
AGCTGGAGCAGTGGAGAACTTTGCAGCGGCACGGCAGGTGTCACGACAAA
CATTCCTCAGTCACGGTGATGACTTCCGTTTCCAGACCAGCCACTTCCAA
CGGGACCAGCTCTATCAGCAGCATTACCAGTGGGACCCACAGTTTGCTCC
TGCGCGCCCACAGGGCCTCTTCGAGAAGCTTCGTGCAGGCCGACCTGGCT
TTGCGGACCCTGATGACTTTGCCTTAGGTGCTGGTCACCGCTTCCCAGAA
CTCGGTGCTGATGTGCACCAACGGCTGGAATACGTGCCATCCAGCGCATC
TCGGGAGGTACGCCACGGCTCGGATCCGGCCTTTGGACCCAGCCCCCGTG
GTCTAGAGCCCAGTGGAGCCTCGCGTCCCAATCTGGGCCAGCGTTTTCCA
TGCCAAGCAACCTTGAGACAAGGCCTGGACACCGCTTCGGAGGCAGAACC
TGAGCGCAGGGGCGGACCCGAGGGCCGGGCCGGGCTGCGTCACTGGCGCC
TTGCCTCCTACCTGAGCGGCTGCCACGGTGACGGTGGGGAGGAGGGTCTA
CCAATGGAGGCTGAGGCTTGTGAAGACGAGGTGCTGGCTCCCGGAGGCCG
GGACCTGCTCCCCTCCGCCTTCCGCACTCCTGCAGCCTTCCCAGCTAAGG
GACCAAAGCCGGGCTCAGGAAGCGGTGGTGGTGACAGCTCCGAGCGAGAG
GGCCCAGAAGAGACAAGCCTGGCTAAGCAGGACTCCTTCCGCTCTCGCTT
GAACCCGCTCATCCAGCGCAGCTCCAGGTTGCGCTCATCACTCATCTTTG
CGTCCCAGGCTGAGGGTGCTGTTGGGACCGCAGCAGCCACCACTGAAAAA
GTACAGCTGATGCACAAAGAACAAACAGTCAGTGAAACTCTGGGTCCCAG
CGGAGAGGCTGTTCGTTCCAGCGCCTCGGCCAAAGTGGCGGAGCTCCTGG
AGAAATACAAGGGCCCTGCCCGGGACCCTGGCGGTGCAGGAGGTGCCGTC
ACTTCCTCCAGCCACAGCAAGGCTGTAGTGTCCCAGGCCTGGCGGGAGGA
GGTGGTAGCACCAGGAGGAGCGGGAACTGAACGCCGCAGCCTTGAGAGTT
GCTTGCTTGACCTGCGCGATTCCTTTGCCCAGCAGTTGCACCAGGAGGCA
GAGCGACACCCAGGAGCCGCTTCGCTCACTGCTGCGCAACTGCTCGACAC
CCTGGGCGGCACTGACCGCCTGCCATCACGCTTCCTCTCCGCCCAGGGCC
GCTCCTTGTCTCCACAAGGTCGAGATAGCCCTCCGCCAGAAGGGCTTGGG
ACACACCAGCTGCCTTATTCTGAGCCAAAGGGAAACCCCACCCCAGCTTA
CCCTGAGCGCAAGGGGAGCCCTACCCCAGCTTACCCTGAGCGCAAGGGGA
GCCCTACCCCAGCTTACCCTGAGCGCAAGGGGAGCCCTACCCCAGCTTAC
CCTGAGCGCAAGGGGAGTCCTACCCAAGCCTACCCTGAGCGCAAGGGGAG
CCCCACGTCTGGATTTCCCAATCGGAGGGGCAGCCCAACCACAGGATTGA
TGGAGCAGAAGGGAAGTCCCACTTCAACCTACCCAGACCGCAGGGGCAGT
CCGGTGCCCCCAGTGCCTGAGCGCAGGGGTAGTCCAGTACCCCCTGTGCC
CGAGCGCAGAGGCAGTCTCACTTTCGCTGGGGAGTCTTCGAAGACTGGGC
CTACAGAGGAGGTGTCTAGTGGCCCCATGGAAGTCCTGCGAAAGGGTTCT
CTCCGCCTCAGGCAGCTGCTGAGCCCCAAGAATGAGAGGCGTGGGGAGGA
TGAGGGCAGCTTCCCAACTCCGCAGGAAAATGGGCAGCCCGAGAGCCCCC
GGCGGCCCTCGCTGAGTCGGGGTGACAGCACAGAGGCTGCTGCAGAGGAG
AGAGGCTCGAGGGTCCGCCTAGCTTCAGCTACAGCCAATGCTCTGTACAG
CAGCAATCTGCGAGATGACACTAAGGCCATTCTGGAGCAAATTAGTGCCC
ACGGCCAGAAGCACCGCGGGGTCCCTGCTCCAGGTCCAGCCCACAGCAGT
CCTGACGTAGGTCGTCCAACAACTGCAGGAGACTTGGCCCCAGACATGTC
CGACAAGGACAAATGTTCAGCTATCTTCCGCTCAGACAGCCTAGGGACAC
AAGGCCGGCTCAGCCGCACCCTGCCTGGCAGTGCAGAGGAGCGAGACCGG
CTCCTTCGCCGCATGGAGAGCATGCGCAAAGAGAAGCGTGTCTACAGTCG
CTTCGAAGTCTTCTGCAAAAAGGACGAAGCTGGCAGTAGTGGGGCAGGAG
ACAACTTGGCAGATGAGGACACCAGGGACAGTAAAATGGGCAAATTTGTC
CCCAAGATCCTGGGCACATTCAAAAGCAAAAAATGAgcggccgc
Amino Acid Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT
TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF
FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN
VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH
YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMARRSQ
SSSQGDNPLAPGYLPPHYKEYYRLAVDALTEGGPEAYNRFLASEGAPDFL
CPEELEHVSRHLQPPQYVAREPPEGTPSDVDMDGSSGTYWPVNSDQAVPE
LDLGWPLTFGFQGTEVTTLVQPPPPDSPSIKDEARRMIRSAQQVVAVVMD
MFTDVDLLSEVLEAAARRVPVYILLDEMNAQHFLDMADKCRVNLHHVDFL
RVRTVAGPTYYCRTGKSFKGHLKEKFLLVDCAVVMSGSYSFMWSFEKIHR
SLAHVFQGELVSSFDEEFRILFAQSEPLVPSAGALARMDAYALAPYSGAG
PLVGVPGVGAPTPFSFPKRAHLLFPPPREEGLGFPSFLDPDRHFLSAFRR
EELQRMPGGALEPHTGLRPLARPTEAGPFGELAGPRGFFQSRHLEMDAFK
RHSYATPDGAGAVENFAAARQVSRQTFLSHGDDFRFQTSHFQRDQLYQQH
YQWDPQFAPARPQGLFEKLRAGRPGFADPDDFALGAGHRFPELGADVHQR
LEYVPSSASREVRHGSDPAFGPSPRGLEPSGASRPNLGQRFPCQATLRQG
LDTASEAEPERRGGPEGRAGLRHWRLASYLSGCHGDGGEEGLPMEAEACE
DEVLAPGGRDLLPSAFRTPAAFPAKGPKPGSGSGGGDSSEREGPEETSLA
KQDSFRSRLNPLIQRSSRLRSSLIFASQAEGAVGTAAATTEKVQLMHKEQ
TVSETLGPSGEAVRSSASAKVAELLEKYKGPARDPGGAGGAVTSSSHSKA
VVSQAWREEVVAPGGAGTERRSLESCLLDLRDSFAQQLHQEAERHPGAAS
LTAAQLLDTLGGTDRLPSRFLSAQGRSLSPQGRDSPPPEGLGTHQLPYSE
PKGNPTPAYPERKGSPTPAYPERKGSPTPAYPERKGSPTPAYPERKGSPT
QAYPERKGSPTSGFPNRRGSPTTGLMEQKGSPTSTYPDRRGSPVPPVPER
RGSPVPPVPERRGSLTFAGESSKTGPTEEVSSGPMEVLRKGSLRLRQLLS
PKNERRGEDEGSFPTPQENGQPESPRRPSLSRGDSTEAAAEERGSRVRLA
SATANALYSSNLRDDTKAILEQISAHGQKHRGVPAPGPAHSSPDVGRPTT
AGDLAPDMSDKDKCSAIFRSDSLGTQGRLSRTLPGSAEERDRLLRRMESM
RKEKRVYSRFEVFCKKDEAGSSGAGDNLADEDTRDSKMGKFVPKILGTFK
SKK*
Vector Type
Mammalian
Antibiotic
Amp
DU Number
DU29683
Location
PPU
MTA
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.