cDNA Clone
(mu)RNF146

Plasmid
pGEX-TEV-(mu)RNF146 Ala30-Arg183
Parent Plasmid
pGEX-TEV
Expressed
GST-RNF146 (RING-WWE)
Genbank
NM_001110196.1
Tag
GST
Species
Mouse
Sequence of Insert
GGATCCGCACCTTCTCTGACAGTTCCTGAATGTGCCATTTGTCTACAAACATGTGTTCACCCTGTCAGTCTGCCCTGTAAGCATGTTTTCTGTTATCTGTGTGTAAAGGGTGCTTCATGGCTTGGGAAGCGATGTGCTCTTTGTCGACAAGAGATTCCTGAGGATTTTCTTGACAAGCCAACCTTGTTGTCACCAGAAGAACTTAAGGCTGCAAGCAGAGGAAATGGTGAATATGCGTGGTATTATGAAGGAAGGAATGGGTGGTGGCAGTATGATGAGCGCACTAGTCGGGAGCTAGAAGATGCTTTTTCCAAAGGTAAAAAGAACACGGAAATGTTAATTGCTGGATTTCTGTATGTTGCTGATCTTGAAAACATGGTTCAATATAGGAGAAATGAACATGGACGTCGCAGGAAGATTAAGCGAGATATAATAGATATACCAAAGAAGGGAGTAGCTGGACTTAGGTAAGCGGCCGC
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDENLYFQGGSAPSLTVPECAICLQTCVHPVS
LPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASR
GNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADL
ENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLR*
Vector Type
Bacterial
Antibiotic
Amp
Full Snapgene Map
pGEX-TEV-(mu)RNF146 Ala30-Arg183724.01 KBSnapgene files can be opened using software available here: www.snapgene.com
DU Number
DU65351
Location
PPU
MTA
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.