cDNA Clone
(mu) MYCBP2

Plasmid
pSc-B-(mu)MYCBP2 nt10107-end
Parent Plasmid
pSC-B
Expressed
Mouse Mycbp2
Genbank
NM_207215.2 → NP_997098.2
Species
Mouse
Sequence of Insert
GGTACCTCGTATGCGATCGCTGTAGAGAAAAATACCTCCGTGAAAAACAG
GCCGCTGCAAGGGAAAAGGTCAAACAATCTAGAAGAAAGCCAATGCAAGT
AAAGACGCCTCGTGCCTTGCCCACCATGGAAGCACACCAGGTGATCAAAG
CCAACGCCCTCTTCCTGCTGTCCCTGAGCAGTGCTGCAGAGCCAAGCATC
TTGTGTTACCACCCTGCAAAGCCATTCCAGTCTCAGCTGCCCATCGTGAA
GGAAGGCGTTTCTGAGGACCTTCCTGTAAAAATGCCTTGTCTCTACTTGC
AGACATTAGCTAGGCACCACCATGAAAATTTTGTGGGCTATCAAGACGAC
AACCTATTCCAGGACGAAATGAGATATCTGCGTTCTACATCTGTCCCTGC
CCCATACATATCAGTAACTCCTGATGCAAGTCCCAATGTATTTGAAGAGC
CAGAGAGCAATATGAAGTCTATGCCACCAAGTTTGGAAACTAGCCCCATA
ACCGACACTGACCTGGCTAAGAGAACTGTCTTCCAAAGGTCATACTCAGT
TGTTGCTTCTGAGTATGATAAACAACATTCCATTTTACCTGCACGAGTTA
AAGCCATCCCTAGAAGAAGAGTGAACAGTGGAGACACTGAAGTTGGGTCT
TCCCTCTTGCGACATCCATCGCCAGAGCTTTCCCGGCTCATATCAGCCCA
CAGCTCTCTTTCCAAAGGAGAACGGAACTTCCAGTGGCCAGTTTTAGCTT
TTGTTATACAGCATCATGATTTAGAAGGGCTTGAAATAGCAATGAAGCAG
GCCTTAAGGAAGTCTGCTTGCCGTGTGTTTGCAATGGAGGCATTCAACTG
GCTTCTCTGTAATGTCATCCAAACAACATCTCTGCATGACATTCTCTGGC
ACTTTGTGGCTGCACTGACGCCTTCTCCCGTAGAAGCAGAGGAAGATGAG
GATGAAGATAATAAATCCAATAAAGAAAATGCAGAGCAAGAGAAGGATAC
AAGAGTGTGTGAGCATCCACTGTCAGATATAGTGATTGCAGGCGAAGCTG
CTCACCCACTGCCACATACGTTTCACCGGTTACTTCAGACCATCTCTGAC
CTTATGATGTCCCTCCCTAGTGGCAGTTCATTGCAACAAATGGCCTTAAG
ATGCTGGAGCCTCAAGTTCAAGCAGTCCGATCACCAGTTCCTCCATCAGA
GCAATGTCTTCCATCACATCAACAACATCTTGTCGAAGTCAGACGATGGA
GACAGTGAGGAGAGCTTCAGCATCAGCGTCCAGTCTGGCTTTGAAGCTAT
GAGCCAGGAATTATGCATAGTTATGTGCCTAAAGGACTTGACTAGCATCG
TTGACATAAAAACATCAAGTCGACCCGCCATGATTGGCAGTTTGACAGAT
GGCTCCACAGAAACCTTTTGGGAATCAGGAGATGAAGATAAAAACAAAAC
TAAAAATATCACTATCAACTGTGTGAAGGGAATTAATGCCCGTTATGTAT
CTGTTCATGTGGACAACTCCCGGGATCTGGGGAATAAAGTTACCTCAATG
ACCTTCTTAACTGGGAAAGCAGTAGAAGAGCTGTGCAGAATAAAGCAGGT
CGATTTGGATTCCAGGCACATTGGCTGGGTCACAAGTGAACTCCCAGGAG
GGGATAATCAGATCATCAAAATAGAGTTAAAGGGCCCAGAAAATACATTA
AGAGTTCGACAAGTAAAAGTCCTGGGTTGGAAAGATGGTGAAAGCACAAA
AATCGCTGGCCAGATCTCAGCCAGTGTGGCTCAGCAAAGGAGCTGTGAGG
CTGAGACTCTCCGAGTGTTCAGACTCATCACCTCTCAAGTGTTTGGAAAG
CTCATCTCTGGAGACGCTGAACCCACACCAGAGCAAGAGGAAAAGGCGCT
CCTGTCCTCCCCTGAAGGAGAAGAAAAAGTATACAATGCGACATCTGATG
CTGACCTGAAGGAACACATGGTTGGAATCATATTCAGCAGGAGTAAACTG
ACTAACCTACAAAAGCAGGTGTGTGCACACATCGTCCAAGCTATTCGCAT
GGAAGCCACAAGAGTCCGGGAAGAATGGGAACACGCCATATCCAGCAAGG
AGAACGCGAACTCCCAGCCCAGTGATGAGGACGCCTCCTCTGACGCTTAC
TGCTTCGAGCTGCTCTCTATGGTCCTAGCGCTGAGCGGCTCCAACGTTGG
CAGACAGTACCTGGCCCAGCAGCTGACTCTGCTGCAGGACCTGTTCTCCT
TGCTCCACACAGCCTCCCCGAGGGTGCAGAGACAGGTGACCTCCTTACTA
AGGCGAGTTTTGCCTGAAGTGACTCCTAACCGTCTGGCCAGTATCATCGG
AGTGAAGTCCCTCCCCCCAGCTGACATCAGTGACATCATTCACTCAACTG
AGAAAGGAGACTGGAATAAGCTGGGTATCTTGGACATGTTTCTGGGATGC
ATTGCCAAGGCGCTCACTGTCCAGCTCAAAGCCAAAGGGACCACCATCAC
TGGGACAGCCGGCACCACTGTGGGCAAAGGAGTTACAACAGTCACCCTGC
CAATGATTTTCAACTCCAGTTACCTCCGACGAGGTGAGAGTCACTGGTGG
ATGAAGGGCTCAACTCCTACTCAGATCTCAGAGATCATCATCAGGCTTAT
CAAGGATATGGCTGCAGGTCACCTGTCAGAAGCTTGGTCCCGAGTGACAA
AAAATGCTATTGCAGAAACCATCATTGCCTTGACCAAAATGGAAGAAGAA
TTTAGGTCTCCAGTGAGATGTATTGCAACAACTAGACTCTGGCTTGCCCT
GGCATCGCTGTGTGTTCTTGATCAGGACCATGTGGACCGCCTCTCCTCGG
GGAGATGGATGGGAAAGGACGGGCAACAGAAGCAAATGCCTATGTGTGAC
AACCATGATGACGGTGAAACTGCAGCTATCATCTTATGCAACATCTGTGG
CAATCTGTGTACTGACTGTGACAGATTCCTTCATCTGCATCGACGAACGA
AGACTCACCAAAGACAGGTCTTCAAAGAAGAAGAAGAGGCTATAAAGGTC
GACCTCCATGAAGGCTGTGGTAGAACAAAACTGTTCTGGTTGATGGCATT
AGCAGATTCTAAAACAATGAAGGCAATGGTGGAATTCCGAGAACACACAG
GCAAACCCACCACGAGTAGCTCGGAAGCATGCCGCTTCTGTGGGTCCAGG
AGTGGAACGGAGCTGTCTGCTGTTGGCAGTGTTTGTTCTGATGCAGACTG
CCAGGAATATGCTAAGATCGCCTGCAGTAAGACACATCCCTGCGGACATC
CGTGTGGAGGTGTTAGAAACGAAGAGCACTGCCTGCCCTGCCTGCACGGC
TGTGATAAGAGCGCCACCACACTGAAACAAGATGCCGACGACATGTGCAT
GATCTGCTTCACCGAAGCGCTCTCTGCAGCACCGGCCATTCAGTTGGACT
GCAGTCATGTGTTCCACTTACAGTGCTGTCGGCGAGTTTTGGAAAACAGA
TGGCTTGGTCCAAGGATAACGTTTGGATTCATTTCGTGTCCTATTTGCAA
GAACAAGATAAATCATATAGTATTAAAAGACCTGCTTGATCCAATAAAAG
AGCTCTATGAAGACGTCAGAAGAAAAGCCTTAATGAGATTGGAGTATGAA
GGTCTGCATAAGAGTGAAGCTATCACGACTCCTGGTGTCAGGTTTTATAA
TGATGCAGCTGGCTATGCCATGAATAGATACGCATATTATGTCTGCTACA
AGTGCAGAAAGGCATACTTTGGTGGTGAGGCTCGCTGTGATGCTGAGGCT
GGACAAGGAGATGATTACGACCCCAGAGAGCTCATCTGCGGCGCCTGTTC
CGATGTGTCCAGGGCCCAGATGTGTCCCAAACATGGAACAGACTTTCTAG
AATACAAGTGTCGCTACTGCTGTTCGGTGGCTGTCTTCTTCTGTTTCGGA
ACAACACATTTCTGTAATGCTTGTCATGATGACTTTCAGAGAATGACCAG
CATTCCTAAGGAAGAACTCCCACACTGTCCTGCAGGTCCCAAAGGCAAGC
AGCTAGAAGGAACTGAGTGTCCACTCCACGTTGTTCATCCGCCCACGGGG
GAAGAGTTTGCTCTCGGGTGCGGCGTGTGCAGAAATGCTCACACGTTTTA
Ggcggccgc
Amino Acid Sequence
YLVCDRCREKYLREKQAAAREKVKQSRRKPMQVKTPRALPTMEAHQVIKA
NALFLLSLSSAAEPSILCYHPAKPFQSQLPIVKEGVSEDLPVKMPCLYLQ
TLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVFEEP
ESNMKSMPPSLETSPITDTDLAKRTVFQRSYSVVASEYDKQHSILPARVK
AIPRRRVNSGDTEVGSSLLRHPSPELSRLISAHSSLSKGERNFQWPVLAF
VIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWH
FVAALTPSPVEAEEDEDEDNKSNKENAEQEKDTRVCEHPLSDIVIAGEAA
HPLPHTFHRLLQTISDLMMSLPSGSSLQQMALRCWSLKFKQSDHQFLHQS
NVFHHINNILSKSDDGDSEESFSISVQSGFEAMSQELCIVMCLKDLTSIV
DIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITINCVKGINARYVS
VHVDNSRDLGNKVTSMTFLTGKAVEELCRIKQVDLDSRHIGWVTSELPGG
DNQIIKIELKGPENTLRVRQVKVLGWKDGESTKIAGQISASVAQQRSCEA
ETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKVYNATSDA
DLKEHMVGIIFSRSKLTNLQKQVCAHIVQAIRMEATRVREEWEHAISSKE
NANSQPSDEDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSL
LHTASPRVQRQVTSLLRRVLPEVTPNRLASIIGVKSLPPADISDIIHSTE
KGDWNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLP
MIFNSSYLRRGESHWWMKGSTPTQISEIIIRLIKDMAAGHLSEAWSRVTK
NAIAETIIALTKMEEEFRSPVRCIATTRLWLALASLCVLDQDHVDRLSSG
RWMGKDGQQKQMPMCDNHDDGETAAIILCNICGNLCTDCDRFLHLHRRTK
THQRQVFKEEEEAIKVDLHEGCGRTKLFWLMALADSKTMKAMVEFREHTG
KPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACSKTHPCGHP
CGGVRNEEHCLPCLHGCDKSATTLKQDADDMCMICFTEALSAAPAIQLDC
SHVFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKE
LYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDAAGYAMNRYAYYVCYK
CRKAYFGGEARCDAEAGQGDDYDPRELICGACSDVSRAQMCPKHGTDFLE
YKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQ
LEGTECPLHVVHPPTGEEFALGCGVCRNAHTF*
Vector Type
Other
Antibiotic
Amp; Kan
DU Number
DU65486
Location
PPU
MTA
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.