cDNA Clone
(Rat)Fbx45

Synonyms
SPRY domain-containing protein 1
Plasmid
pFBDM-SKP1 isoform 1, StrepII-3C-(Rat)Fbxo45
Parent Plasmid
pFBDM
Expressed
StrepII-3C-(Rat)Fbxo45
Genbank
XM_017598223.1 Uniprot: A0A0G2JWY6
Tag
StrepII
Species
Rat
Sequence of Insert
ccATGGGTTGGTCTCATCCTCAATTCGAGAAGCTGGAGGTGCTGTTCCAG
GGTCCTGGTCCTGGTGCTGGTGCTCCTGCTGGTAGCGGTGCTGCTGGTGG
TCCTGCTTCAGCTAGAGGCGCTTCTGCTGGTGCTGGTTCTGCTTCATCTG
GTATCGGTGGTAGACTCGATCAAGCTGGTGCTTGGATGGTTTTCTCTTCA
TGGTCTTGCCCAGCTTGCGGTTCTTGTGCTCTGGTATGCAGGCAGGGTAC
CGCTGCTCTGCACGGAGATGAAACTTCCGAGGTGTGGCGCTCCCTGTGCG
CTCGCTCCCTGGCTGAGGAGGCTCTGCGTACAGACATCCTGTGCAACCTG
CCCAGCTACAAGGCAAAGGTTCGCGCCTTCCAACACGCCTTTTCTACTAA
CGATTGCTCTCGCAATGTGTACATCAAAAAGAACGGGTTTACTCTGCACA
GGAACCCTATCGCTCAATCCACCGACGGTGCTCGTACCAAGATCGGTTTC
TCCGAGGGTCGCCACGCGTGGGAAGTGTGGTGGGAGGGCCCACTGGGTAC
AGTGGCTGTGATCGGTATCGCTACCAAGCGCGCTCCCATGCAGTGCCAGG
GCTACGTGGCTCTGCTGGGCTCCGACGACCAGTCCTGGGGTTGGAACTTG
GTGGACAACAACCTGCTGCACAACGGAGAGGTGAACGGTTCCTTCCCCCA
GTGCAACAACGCTCCTAAGTATCAGATCGGCGAGCGTATCCGCGTGATCC
TGGACATGGAGGACAAGACCCTGGCTTTCGAGCGCGGCTACGAGTTCCTG
GGTGTGGCTTTCCGCGGTCTGCCTAAGGCTTGCCTTTACCCCGCCGTTTC
TGCCGTTTATGGCAACACCGAGGTCACTCTTGTATACCTGGGAAAGCCTC
TGGACGGTTAAGCATGC
Amino Acid Sequence
MGWSHPQFEKLEVLFQGPGPGAGAPAGSGAAGGPASARGASAGAGSASSG
IGGRLDQAGAWMVFSSWSCPACGSCALVCRQGTAALHGDETSEVWRSLCA
RSLAEEALRTDILCNLPSYKAKVRAFQHAFSTNDCSRNVYIKKNGFTLHR
NPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQG
YVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVIL
DMEDKTLAFERGYEFLGVAFRGLPKACLYPAVSAVYGNTEVTLVYLGKPL
DG*
Vector Type
Baculovirus
Antibiotic
Amp
Full Snapgene Map
pFBDM-SKP1 isoform 1, StrepII-3C-(Rat)Fbxo45 173.63 KBSnapgene files can be opened using software available here: www.snapgene.com
DU Number
DU65636
Location
PPU
MTA
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.