cDNA Clone SERPINA1

• Synonyms: alpha-1-antitrypsin precursor
• Plasmid: pcDNA5 FRT-TO-SERPINA1(p.Ser343Argfs*16)-HSV
• Parent Plasmid: pcDNA5 FRT-TO
• Expressed: SERPINA Hong Kong null mutant
• Genbank: NM_000295.5/NP_000286.3

Sequence of Insert

see attached Snapgene file

Amino Acid Sequence

MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLRGHRGGTPEALQGRAQPELAPEDPED*

• Vector Type: Mammalian
• Antibiotic: Amp
• Full Snapgene Map: pcDNA5 FRT-TO-SERPINA1(p.Ser343Argfs*16)-HSV544.05 KB Snapgene files can be opened using software available here: www.snapgene.com
• DU Number: DU71430
• Unit Source: Protein Phosphorylation and Ubiquitylation Unit
• Location: PPU
• MTA: Dundee
• Notes: Null Hong Kong mutant – A two nucleotide deletion in the codon encoding Leu342 (the Thymine at the 2nd nucleotide position and the Cytosine at the 3rd nucleotide position) induces a frameshift (p.Ser343Argfs*16) that maintains the Leucine at position 342, and introduces the following downstream sequence: RGHRGGTPEALQGRA*; Parental 41459
• Low Temp: No