cDNA Clone LC3C

• Synonyms: ATG8J, LC3C MAP1LC3C
• Plasmid: pET15b 6His TEV LC3C M1-G126
• Parent Plasmid: pET15b 6His TEV1
• Expressed: 6His TEV LC3C M1-G126
• Genbank: NM_004849.2 GI:92859692
• Tag: 6His
• Species: Human

Amino Acid Sequence

MGSSHHHHHHSSGENLYFQGHMLGSMPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRS
RMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFG*

• Vector Type: Bacterial
• Antibiotic: Amp
• Full Snapgene Map: pET15b 6His TEV LC3C M1-G126268.83 KB Snapgene files can be opened using software available here: www.snapgene.com
• DU Number: DU40044
• Unit Source: Protein Phosphorylation and Ubiquitylation Unit
• Location: PPU
• MTA: Dundee
• Low Temp: No