cDNA Clone TIMM50

• Synonyms: isoform1
• Plasmid: pCMV TIMM50 1-143 HA
• Parent Plasmid: pCMV5 C-HA
• Expressed: TIMM50 (isoform 1) (aa 1-143)) -HA
• Genbank: Q3ZCQ8
• Tag: HA
• Species: Human

Sequence of Insert

ggatccatggcctcagctttatctctgggcaataagtgtgatcccttccttcgctgcgtcctttgcaggggcggtggcgctctgcaaggcccaagggggcgtggtccagatgactttgaatcccagttgtcgcccccagggtcagccaggagactagtcagaagcaaacgcgcctgcggcaatccgcccgatgcctttggtctctctcgggcttccgtccacccgcccctcccccgcgtttccattggctgtagctccggcccggggcgggcgaagagggagcgagtgggcggggccgcgtggcgtcagcgcaagatggcggcctcggcagcggtgttctcgcgcttgcgaagcgggctccggctcggctcgcggggactgtgcacgaggttggcgacgccgccccgccgggccccagatcaggccgcagagatcgcggccgc

Amino Acid Sequence

MASALSLGNKCDPFLRCVLCRGGGALQGPRGRGPDDFESQLSPPGSARRLVRSKRACGNPPDAFGLSRASVHPPLPRVSIGCSSGPGRAKRERVGGAAWRQRKMAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIAAAYPYDVPDYA*

• Vector Type: Mammalian
• Antibiotic: Amp
• DU Number: DU43447
• Unit Source: Protein Phosphorylation and Ubiquitylation Unit
• Location: PPU
• MTA: Dundee
• Notes: in pCMV5