cDNA Clone SUMO-2

• Plasmid: pHis-TEV-30a-SUMO-2
• Parent Plasmid: pHIS-TEV-30a
• Expressed: SUMO-2
• Genbank: NP_008867.2
• Tag: 6His
• Species: Human

Sequence of Insert

ATGTCGTACTACCATCACCATCACCATCACGATTACGATATCCCAACGACCGAAAACCTGTATTTTCAGGGCTCCGAGGAGAAGCCCAAGGAGGGTGTGAAGACAGAGAATGACCACATCAACCTGAAGGTGGCCGGGCAGGACGGCTCCGTGGTGCAGTTCAAGATCAAGAGGCACACGCCGCTGAGCAAGCTGATGAAGGCCTACTGCGAGAGGCAGGGCTTGTCAATGAGGCAGATCAGATTCAGGTTCGACGGGCAGCCAATCAATGAAACTGACACTCCAGCACAGCTGGAGATGGAGGACGAGGACACCATCGACGTGTTCCAGCAGCAGACGGGAGGTTAGTGAAAGCTT

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGSEEKPKEGVKTENDHINLKVAGQDGS
VVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEM
EDEDTIDVFQQQTGG**

• Vector Type: Bacterial
• Antibiotic: Kan
• DU Number: DU24720
• Unit Source: Protein Phosphorylation and Ubiquitylation Unit
• Location: PPU
• MTA: Dundee
• Notes: subcloned into pHISTEV30a vector using EcoRV and HindIII restriction sites ; note: EcoRV cleaves the pHISTEV30a plasmid twice, once before the coding ; sequence for the TEV protease cleavage site and once in the polylinker. Digestion of the pHISTEV30a vector with EcoRV thus removes the TEV protease cleavage site. The coding sequence for the TEV protease cleavage site was therefore included in the forward primer. ; .after cleavage with TEV protease, the construct corresponds to the mature form of SUMO-2 with the diglycine motif at the C-terminus; the first methionine is mutated to a glycine