cDNA Clone
(chicken) CDKL5

Plasmid
pcDNA5D FRT/TO Chicken CDKL5 K42R TEV GST 6His
Parent Plasmid
pcDNA5D FRT/TO C-TEV GST 6His
Expressed
Chicken CDKL5 K42R TEV GST 6His
Genbank
Sequence provided by Michael Morgan
Tag
GST
Species
Chicken
Sequence of Insert
GGATCCGCCACCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGTGTTGTACTTAAATGCAGACACAAGGAGACACATGAAATTGTGGCTATCAGGAAATTCAAAGACAGTGAAGAAAATGAAGAAGTCAAAGAAACCACTTTACGAGAACTTAAAATGCTTCGCACTTTAAAACAGGAGAACATAGTGGAGCTGAAGGAAGCCTTCAGAAGAAGAGGAAAATTATACTTAGTTTTTGAATATGTGGAAAAAAATATGCTTGAATTGCTAGAAGAAATGCCAAATGGAGTTCCACCAGAAAAAGTGAAAAGTTATATCTACCAGCTAATTAAAGCAATTCATTGGTGTCATAAGAATGATATCGTTCATAGAGATATCAAACCAGAGAATCTCTTAATAAGCCACAATGATGTTCTGAAATTGTGTGACTTTGGCTTTGCCCGTAATCTTTCTGAAGGAAGCAATGCTAACTATACAGAATATGTGGCTACCAGGTGGTACCGCTCACCCGAACTCTTGCTTGGAGCCCCATATGGAAAGGCTGTGGATATGTGGTCTGTGGGCTGTATTCTGGGTGAGCTGAGTGACGGACAGCCCTTGTTCCCAGGGGAGAGCGAGATTGACCAGCTCTTTACCATTCAGAAGGTGCTAGGCCCACTGCCAGCTGAGCAGATGAAGCTCTTCTACAGCAACCCACGCTTCCATGGACTGAGGTTTCCTGCAGTCAATCATCCACAATCTTTAGAGAGAAGATACTTGGGAATTTTAAGTGGTGTTTTGCTTGATCTTATGAAGAACTTACTGAAGTTAGATCCAGCAGACAGATACTTGACAGAACAATGTTTGAACCATCCTTCATTTCAAACACAAAGACTCTTGGATCGCTGTGGAAGTTCACCTTCACGATCAGCTAAAAGAAAGCCTTACCACGTCGACAGCAACACATTATCTAACAGAAATCAAGCCAGCAAAAGTTCTGCTTTGCAGTCACACCACAGATCAAACAGCAAGGATATACAGACACTAGGGATTGGCGGGCCAAGAGAAGAGGGTCTTCCAGCAAATGAAAGCTTTTTAAATGGAAACCTCTCTGGAGCTGCACATAGCCCAATGCACGCGAAGAAATCAAGCAACCAGCCTGGATCTGGCAATAAAGATCTAGCCAACAATAACATGCCACATCTTCTTAGTCCAAAGGAAACAAAGGCAAAAACAGAATTTGATTTTAATGTGGACCCAAAAAGTTCTGATGGTCCAGGTACGAAGTACCTGAAGTCTAACACCAGATCTCAGCAGAACCGGCACTCATTTATGGAAACGTCTCAAAGCAAAACTGGGACGCTGCAGCCCGGCGATAAGCATAGTCGCCACAGCTATATTGATACCATTCCACAGTCTTCTAAGAGTCCTTCGTATCGGACAAAGTCAAAGAGCCATGGGGTTCTGACAGACTCAAAATCCGTGGGCAACCTATCTGAGGCCAGGGCTCAAGCTGCAGAACCAAACAGCAGTCGCTATTTTCCATCCAGCTGTATGGACTTGAACTCTCCTACCAGTCCGACCGCTCCCCGCCATAGCGATAACAGAACTTTGCTCAGCCCGTCTGGGAGGAATAACCGCAGCGAGGGTACCCTGGACACCCGAAGACCTTCAACCAGACACTCCAAAACAATGGAGGAGTTAAAACTGCCAGATCACATGGATGGAAGCCATTCCCACTCGCTCTCTGCTCCACACGAATCTTTTTCCTATGGCCTAGGTTATACCAGTCCTTTCTCTTCACAGCAGCGCCCTCATAGACACTCTATGTATGTGAGCCGGGACAGAGTGAGGTCAAAGGGCTCAGAGGGTGGCTTAAGCGTAGGGCAAGGGATGGCAGCCAGAGCAAACAGCCTGCAACTGTTATCTCCACAGGTGCAGCATAAGTCACTCACAAGGTCTGTTGGCTCTTCACGAGAAGACTGTACAGAAGATACTAATAGGGGTGGAGCATATCATGATCCACACACAGAAGATGGAGCATCTACTAAGGAAAATAGAATTCTGTATAATGAAGCTGTTCCAAGAAGAGTTGGCAGTTTTTACAGAGTTCCATCTCCGCGTCCAGACAGCACATACATAGAAAACAATGTGTCAAACAGAGCCTCTGTACTACCAGCAGACAGCAGCACGGTGGCAAACCACTCAAAGAGACAAACCACCTTTGATACCTGGAAAAGTCCTGAAAATCTTAACAGTCACTCTGAGCAGCTTAAGGAGAAAGAAAAGCAAGGTTTTTTCAGGGCAATAAAGAAGAAAAAGAAGAAATCTCAAACCATGCCTGGCACTGATGGTCAGGATCTCCTGGCGTTACAGAAAGCCATTCATTCTTCTAATCACCAGAGCAGCAGGCAGAAGGATTGGCATCCTGAGAAGATGACAGAAATCCAGCCTCATAGCCAGCCATTAAAATCTCTGCGAAAGCTATTACACCTCTCTTCAAATCATCCCATCCCTGCTGAGCCTCGCTTCCAACCCTTACCAAGTCAGCCGGCCAAACCTGCTTTTTCTGAAGTGCGAATTCACCCCATGAGTCAAAGCTCCAGCAGCGGCAGCAGCAACGCACGGCAGGAGCCGCAGCCAAAGAGCCGGCCGACGCTGCAGATCCCGAGCCAGCTGGAGCCCACCTGGCACGTCTCCCCCGTCAACAGGAGCGCCAGCGATGGGCCCCCCTACTCCGAGCAGCCACCTTCCAAGAGTGGACAGAACGGGCACACGTATAACCGAACAAACCGGTCACGAATGCCAAATCTGAATGATCTAAAAGAGACGGCCTTGGCGGCCGC

Amino Acid Sequence
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIRKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELL
EEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGSNANYTEYVATRWYRSPELLLGAPYGKAVDMWSVGCI
LGELSDGQPLFPGESEIDQLFTIQKVLGPLPAEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILSGVLLDLMKNLLKLDPADRYLTEQCLNHPSFQTQ
RLLDRCGSSPSRSAKRKPYHVDSNTLSNRNQASKSSALQSHHRSNSKDIQTLGIGGPREEGLPANESFLNGNLSGAAHSPMHAKKSSNQPGSGNKDLANN
NMPHLLSPKETKAKTEFDFNVDPKSSDGPGTKYLKSNTRSQQNRHSFMETSQSKTGTLQPGDKHSRHSYIDTIPQSSKSPSYRTKSKSHGVLTDSKSVGN
LSEARAQAAEPNSSRYFPSSCMDLNSPTSPTAPRHSDNRTLLSPSGRNNRSEGTLDTRRPSTRHSKTMEELKLPDHMDGSHSHSLSAPHESFSYGLGYTS
PFSSQQRPHRHSMYVSRDRVRSKGSEGGLSVGQGMAARANSLQLLSPQVQHKSLTRSVGSSREDCTEDTNRGGAYHDPHTEDGASTKENRILYNEAVPRR
VGSFYRVPSPRPDSTYIENNVSNRASVLPADSSTVANHSKRQTTFDTWKSPENLNSHSEQLKEKEKQGFFRAIKKKKKKSQTMPGTDGQDLLALQKAIHS
SNHQSSRQKDWHPEKMTEIQPHSQPLKSLRKLLHLSSNHPIPAEPRFQPLPSQPAKPAFSEVRIHPMSQSSSSGSSNARQEPQPKSRPTLQIPSQLEPTW
HVSPVNRSASDGPPYSEQPPSKSGQNGHTYNRTNRSRMPNLNDLKETALAAAMENLYFQGAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKW
RNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKT
YLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDHHHHHH*
Vector Type
Mammalian
Antibiotic
Amp
DU Number
DU63876
Location
PPU
MTA
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.