cDNA Clone
(chicken) CDKL5

Plasmid
pEX Chicken CDKL5 K42R TEV GST 6His
Parent Plasmid
pEX C-TEV GST 6His
Expressed
Chicken CDKL5 K42R TEV GST 6His
Genbank
Sequence provided by Michael Morgan.
Tag
GST
6His
Species
Chicken
Sequence of Insert
GGATCCGCCACCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGTGTTGTACTTAAATGCAGACACAAGGAGACACATGAAATTGTGGCTATCAGGAAATTCAAAGACAGTGAAGAAAATGAAGAAGTCAAAGAAACCACTTTACGAGAACTTAAAATGCTTCGCACTTTAAAACAGGAGAACATAGTGGAGCTGAAGGAAGCCTTCAGAAGAAGAGGAAAATTATACTTAGTTTTTGAATATGTGGAAAAAAATATGCTTGAATTGCTAGAAGAAATGCCAAATGGAGTTCCACCAGAAAAAGTGAAAAGTTATATCTACCAGCTAATTAAAGCAATTCATTGGTGTCATAAGAATGATATCGTTCATAGAGATATCAAACCAGAGAATCTCTTAATAAGCCACAATGATGTTCTGAAATTGTGTGACTTTGGCTTTGCCCGTAATCTTTCTGAAGGAAGCAATGCTAACTATACAGAATATGTGGCTACCAGGTGGTACCGCTCACCCGAACTCTTGCTTGGAGCCCCATATGGAAAGGCTGTGGATATGTGGTCTGTGGGCTGTATTCTGGGTGAGCTGAGTGACGGACAGCCCTTGTTCCCAGGGGAGAGCGAGATTGACCAGCTCTTTACCATTCAGAAGGTGCTAGGCCCACTGCCAGCTGAGCAGATGAAGCTCTTCTACAGCAACCCACGCTTCCATGGACTGAGGTTTCCTGCAGTCAATCATCCACAATCTTTAGAGAGAAGATACTTGGGAATTTTAAGTGGTGTTTTGCTTGATCTTATGAAGAACTTACTGAAGTTAGATCCAGCAGACAGATACTTGACAGAACAATGTTTGAACCATCCTTCATTTCAAACACAAAGACTCTTGGATCGCTGTGGAAGTTCACCTTCACGATCAGCTAAAAGAAAGCCTTACCACGTCGACAGCAACACATTATCTAACAGAAATCAAGCCAGCAAAAGTTCTGCTTTGCAGTCACACCACAGATCAAACAGCAAGGATATACAGACACTAGGGATTGGCGGGCCAAGAGAAGAGGGTCTTCCAGCAAATGAAAGCTTTTTAAATGGAAACCTCTCTGGAGCTGCACATAGCCCAATGCACGCGAAGAAATCAAGCAACCAGCCTGGATCTGGCAATAAAGATCTAGCCAACAATAACATGCCACATCTTCTTAGTCCAAAGGAAACAAAGGCAAAAACAGAATTTGATTTTAATGTGGACCCAAAAAGTTCTGATGGTCCAGGTACGAAGTACCTGAAGTCTAACACCAGATCTCAGCAGAACCGGCACTCATTTATGGAAACGTCTCAAAGCAAAACTGGGACGCTGCAGCCCGGCGATAAGCATAGTCGCCACAGCTATATTGATACCATTCCACAGTCTTCTAAGAGTCCTTCGTATCGGACAAAGTCAAAGAGCCATGGGGTTCTGACAGACTCAAAATCCGTGGGCAACCTATCTGAGGCCAGGGCTCAAGCTGCAGAACCAAACAGCAGTCGCTATTTTCCATCCAGCTGTATGGACTTGAACTCTCCTACCAGTCCGACCGCTCCCCGCCATAGCGATAACAGAACTTTGCTCAGCCCGTCTGGGAGGAATAACCGCAGCGAGGGTACCCTGGACACCCGAAGACCTTCAACCAGACACTCCAAAACAATGGAGGAGTTAAAACTGCCAGATCACATGGATGGAAGCCATTCCCACTCGCTCTCTGCTCCACACGAATCTTTTTCCTATGGCCTAGGTTATACCAGTCCTTTCTCTTCACAGCAGCGCCCTCATAGACACTCTATGTATGTGAGCCGGGACAGAGTGAGGTCAAAGGGCTCAGAGGGTGGCTTAAGCGTAGGGCAAGGGATGGCAGCCAGAGCAAACAGCCTGCAACTGTTATCTCCACAGGTGCAGCATAAGTCACTCACAAGGTCTGTTGGCTCTTCACGAGAAGACTGTACAGAAGATACTAATAGGGGTGGAGCATATCATGATCCACACACAGAAGATGGAGCATCTACTAAGGAAAATAGAATTCTGTATAATGAAGCTGTTCCAAGAAGAGTTGGCAGTTTTTACAGAGTTCCATCTCCGCGTCCAGACAGCACATACATAGAAAACAATGTGTCAAACAGAGCCTCTGTACTACCAGCAGACAGCAGCACGGTGGCAAACCACTCAAAGAGACAAACCACCTTTGATACCTGGAAAAGTCCTGAAAATCTTAACAGTCACTCTGAGCAGCTTAAGGAGAAAGAAAAGCAAGGTTTTTTCAGGGCAATAAAGAAGAAAAAGAAGAAATCTCAAACCATGCCTGGCACTGATGGTCAGGATCTCCTGGCGTTACAGAAAGCCATTCATTCTTCTAATCACCAGAGCAGCAGGCAGAAGGATTGGCATCCTGAGAAGATGACAGAAATCCAGCCTCATAGCCAGCCATTAAAATCTCTGCGAAAGCTATTACACCTCTCTTCAAATCATCCCATCCCTGCTGAGCCTCGCTTCCAACCCTTACCAAGTCAGCCGGCCAAACCTGCTTTTTCTGAAGTGCGAATTCACCCCATGAGTCAAAGCTCCAGCAGCGGCAGCAGCAACGCACGGCAGGAGCCGCAGCCAAAGAGCCGGCCGACGCTGCAGATCCCGAGCCAGCTGGAGCCCACCTGGCACGTCTCCCCCGTCAACAGGAGCGCCAGCGATGGGCCCCCCTACTCCGAGCAGCCACCTTCCAAGAGTGGACAGAACGGGCACACGTATAACCGAACAAACCGGTCACGAATGCCAAATCTGAATGATCTAAAAGAGACGGCCTTGGCGGCCGC
Amino Acid Sequence
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELL
EEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGSNANYTEYVATRWYRSPELLLGAPYGKAVDMWSVGCI
LGELSDGQPLFPGESEIDQLFTIQKVLGPLPAEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILSGVLLDLMKNLLKLDPADRYLTEQCLNHPSFQTQ
RLLDRCGSSPSRSAKRKPYHVDSNTLSNRNQASKSSALQSHHRSNSKDIQTLGIGGPREEGLPANESFLNGNLSGAAHSPMHAKKSSNQPGSGNKDLANN
NMPHLLSPKETKAKTEFDFNVDPKSSDGPGTKYLKSNTRSQQNRHSFMETSQSKTGTLQPGDKHSRHSYIDTIPQSSKSPSYRTKSKSHGVLTDSKSVGN
LSEARAQAAEPNSSRYFPSSCMDLNSPTSPTAPRHSDNRTLLSPSGRNNRSEGTLDTRRPSTRHSKTMEELKLPDHMDGSHSHSLSAPHESFSYGLGYTS
PFSSQQRPHRHSMYVSRDRVRSKGSEGGLSVGQGMAARANSLQLLSPQVQHKSLTRSVGSSREDCTEDTNRGGAYHDPHTEDGASTKENRILYNEAVPRR
VGSFYRVPSPRPDSTYIENNVSNRASVLPADSSTVANHSKRQTTFDTWKSPENLNSHSEQLKEKEKQGFFRAIKKKKKKSQTMPGTDGQDLLALQKAIHS
SNHQSSRQKDWHPEKMTEIQPHSQPLKSLRKLLHLSSNHPIPAEPRFQPLPSQPAKPAFSEVRIHPMSQSSSSGSSNARQEPQPKSRPTLQIPSQLEPTW
HVSPVNRSASDGPPYSEQPPSKSGQNGHTYNRTNRSRMPNLNDLKETALAAAENLYFQGMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKW
RNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKT
YLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDHHHHHH*
Vector Type
Bacterial
Antibiotic
Amp
DU Number
DU63877
Location
PPU
MTA
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.