cDNA Clone
(chicken) CDKL5

Plasmid
pBabeD puro Chicken CDKL5 TEV GST 6His
Parent Plasmid
pBabeD puro
Expressed
Chicken CDKL5 TEV GST 6His
Genbank
Sequence provided by Michael Morgan
Tag
GST
Species
Chicken
Sequence of Insert
GGATCCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGTGTTGTACTTAAATGCAGACACAAGGAGACACATGAAATTGTGGCTATCAAGAAATTCAAAGACAGTGAAGAAAATGAAGAAGTCAAAGAAACCACTTTACGAGAACTTAAAATGCTTCGCACTTTAAAACAGGAGAACATAGTGGAGCTGAAGGAAGCCTTCAGAAGAAGAGGAAAATTATACTTAGTTTTTGAATATGTGGAAAAAAATATGCTTGAATTGCTAGAAGAAATGCCAAATGGAGTTCCACCAGAAAAAGTGAAAAGTTATATCTACCAGCTAATTAAAGCAATTCATTGGTGTCATAAGAATGATATCGTTCATAGAGATATCAAACCAGAGAATCTCTTAATAAGCCACAATGATGTTCTGAAATTGTGTGACTTTGGCTTTGCCCGTAATCTTTCTGAAGGAAGCAATGCTAACTATACAGAATATGTGGCTACCAGGTGGTACCGCTCACCCGAACTCTTGCTTGGAGCCCCATATGGAAAGGCTGTGGATATGTGGTCTGTGGGCTGTATTCTGGGTGAGCTGAGTGACGGACAGCCCTTGTTCCCAGGGGAGAGCGAGATTGACCAGCTCTTTACCATTCAGAAGGTGCTAGGCCCACTGCCAGCTGAGCAGATGAAGCTCTTCTACAGCAACCCACGCTTCCATGGACTGAGGTTTCCTGCAGTCAATCATCCACAATCTTTAGAGAGAAGATACTTGGGAATTTTAAGTGGTGTTTTGCTTGATCTTATGAAGAACTTACTGAAGTTAGATCCAGCAGACAGATACTTGACAGAACAATGTTTGAACCATCCTTCATTTCAAACACAAAGACTCTTGGATCGCTGTGGAAGTTCACCTTCACGATCAGCTAAAAGAAAGCCTTACCACGTCGACAGCAACACATTATCTAACAGAAATCAAGCCAGCAAAAGTTCTGCTTTGCAGTCACACCACAGATCAAACAGCAAGGATATACAGACACTAGGGATTGGCGGGCCAAGAGAAGAGGGTCTTCCAGCAAATGAAAGCTTTTTAAATGGAAACCTCTCTGGAGCTGCACATAGCCCAATGCACGCGAAGAAATCAAGCAACCAGCCTGGATCTGGCAATAAAGATCTAGCCAACAATAACATGCCACATCTTCTTAGTCCAAAGGAAACAAAGGCAAAAACAGAATTTGATTTTAATGTGGACCCAAAAAGTTCTGATGGTCCAGGTACGAAGTACCTGAAGTCTAACACCAGATCTCAGCAGAACCGGCACTCATTTATGGAAACGTCTCAAAGCAAAACTGGGACGCTGCAGCCCGGCGATAAGCATAGTCGCCACAGCTATATTGATACCATTCCACAGTCTTCTAAGAGTCCTTCGTATCGGACAAAGTCAAAGAGCCATGGGGTTCTGACAGACTCAAAATCCGTGGGCAACCTATCTGAGGCCAGGGCTCAAGCTGCAGAACCAAACAGCAGTCGCTATTTTCCATCCAGCTGTATGGACTTGAACTCTCCTACCAGTCCGACCGCTCCCCGCCATAGCGATAACAGAACTTTGCTCAGCCCGTCTGGGAGGAATAACCGCAGCGAGGGTACCCTGGACACCCGAAGACCTTCAACCAGACACTCCAAAACAATGGAGGAGTTAAAACTGCCAGATCACATGGATGGAAGCCATTCCCACTCGCTCTCTGCTCCACACGAATCTTTTTCCTATGGCCTAGGTTATACCAGTCCTTTCTCTTCACAGCAGCGCCCTCATAGACACTCTATGTATGTGAGCCGGGACAGAGTGAGGTCAAAGGGCTCAGAGGGTGGCTTAAGCGTAGGGCAAGGGATGGCAGCCAGAGCAAACAGCCTGCAACTGTTATCTCCACAGGTGCAGCATAAGTCACTCACAAGGTCTGTTGGCTCTTCACGAGAAGACTGTACAGAAGATACTAATAGGGGTGGAGCATATCATGATCCACACACAGAAGATGGAGCATCTACTAAGGAAAATAGAATTCTGTATAATGAAGCTGTTCCAAGAAGAGTTGGCAGTTTTTACAGAGTTCCATCTCCGCGTCCAGACAGCACATACATAGAAAACAATGTGTCAAACAGAGCCTCTGTACTACCAGCAGACAGCAGCACGGTGGCAAACCACTCAAAGAGACAAACCACCTTTGATACCTGGAAAAGTCCTGAAAATCTTAACAGTCACTCTGAGCAGCTTAAGGAGAAAGAAAAGCAAGGTTTTTTCAGGGCAATAAAGAAGAAAAAGAAGAAATCTCAAACCATGCCTGGCACTGATGGTCAGGATCTCCTGGCGTTACAGAAAGCCATTCATTCTTCTAATCACCAGAGCAGCAGGCAGAAGGATTGGCATCCTGAGAAGATGACAGAAATCCAGCCTCATAGCCAGCCATTAAAATCTCTGCGAAAGCTATTACACCTCTCTTCAAATCATCCCATCCCTGCTGAGCCTCGCTTCCAACCCTTACCAAGTCAGCCGGCCAAACCTGCTTTTTCTGAAGTGCGAATTCACCCCATGAGTCAAAGCTCCAGCAGCGGCAGCAGCAACGCACGGCAGGAGCCGCAGCCAAAGAGCCGGCCGACGCTGCAGATCCCGAGCCAGCTGGAGCCCACCTGGCACGTCTCCCCCGTCAACAGGAGCGCCAGCGATGGGCCCCCCTACTCCGAGCAGCCACCTTCCAAGAGTGGACAGAACGGGCACACGTATAACCGAACAAACCGGTCACGAATGCCAAATCTGAATGATCTAAAAGAGACGGCCTTGGCGGCCGCTATGGAAAACCTGTATTTTCAGGGCGCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCACTCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATGAGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTGGAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACAGTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTGGTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTGGATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAACTCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCGAAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCATCCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCCAATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTGAAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCATGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCCAAAATCGGATcaccatcaccatcaccatTGActcgag
Amino Acid Sequence
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELL
EEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGSNANYTEYVATRWYRSPELLLGAPYGKAVDMWSVGCI
LGELSDGQPLFPGESEIDQLFTIQKVLGPLPAEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILSGVLLDLMKNLLKLDPADRYLTEQCLNHPSFQTQ
RLLDRCGSSPSRSAKRKPYHVDSNTLSNRNQASKSSALQSHHRSNSKDIQTLGIGGPREEGLPANESFLNGNLSGAAHSPMHAKKSSNQPGSGNKDLANN
NMPHLLSPKETKAKTEFDFNVDPKSSDGPGTKYLKSNTRSQQNRHSFMETSQSKTGTLQPGDKHSRHSYIDTIPQSSKSPSYRTKSKSHGVLTDSKSVGN
LSEARAQAAEPNSSRYFPSSCMDLNSPTSPTAPRHSDNRTLLSPSGRNNRSEGTLDTRRPSTRHSKTMEELKLPDHMDGSHSHSLSAPHESFSYGLGYTS
PFSSQQRPHRHSMYVSRDRVRSKGSEGGLSVGQGMAARANSLQLLSPQVQHKSLTRSVGSSREDCTEDTNRGGAYHDPHTEDGASTKENRILYNEAVPRR
VGSFYRVPSPRPDSTYIENNVSNRASVLPADSSTVANHSKRQTTFDTWKSPENLNSHSEQLKEKEKQGFFRAIKKKKKKSQTMPGTDGQDLLALQKAIHS
SNHQSSRQKDWHPEKMTEIQPHSQPLKSLRKLLHLSSNHPIPAEPRFQPLPSQPAKPAFSEVRIHPMSQSSSSGSSNARQEPQPKSRPTLQIPSQLEPTW
HVSPVNRSASDGPPYSEQPPSKSGQNGHTYNRTNRSRMPNLNDLKETALAAAMENLYFQGAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKW
RNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKT
YLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDHHHHHH*
Vector Type
Mammalian
Antibiotic
Amp
DU Number
DU63929
Location
PPU
MTA
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.