cDNA Clone Ubiquitin

• Plasmid: pET24a untagged Ubiquitin 1-76 K6R K48R K63R T66C
• Parent Plasmid: pET24a
• Expressed: Ubiquitin 1-76 K6R K48R K63R T66C
• Genbank: -
• Tag: untagged

Amino Acid Sequence

MQIFVRTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGRQLEDGRTLSDYNIQRESCLHLVLRLRGG*

• Vector Type: Bacterial
• Antibiotic: Kan
• Full Snapgene Map: pET24a untagged Ubiquitin 1-76 K6R K48R K63R T66C271.13 KB Snapgene files can be opened using software available here: www.snapgene.com
• DU Number: DU67492
• Unit Source: Protein Phosphorylation and Ubiquitylation Unit
• Location: PPU
• MTA: Dundee
• Notes: Clone made and deposited by Sven Lange
• Low Temp: No