Substrate Peptides
| Title | Peptide Sequence | Substrate For | Derived from | Price | Add to cart |
|---|---|---|---|---|---|
| Generic Protein Kinase Substrate | RARTLSFAEPG | Generic Substrate | Price
£25.00
|
||
| Glycogen Synthase Peptide 2 | YRRAAVPPSPSLSRHSSPHQS(phospho)EDEEE | GSK3 | Glycogen synthase derived peptide | Price
£25.00
|
|
| Glycogen Synthase Peptide 2 (Ala 21) | YRRAAVPPSPSLSRHSSPHQAEDEEE | GSK3 Negative Control | Glycogen synthase derived peptide | Price
£25.00
|
|
| GSK3 Substrate Peptide | RRAAEELDSRAGS(phospho)PQL | GSK3 | eIF2B derived peptide | Price
£25.00
|
|
| HER2 Substrate Peptide | GGMEDIYFEFMGGKKK | HER2, cKIT, TIE2 | identified by screening a degenerate peptide library | Price
£25.00
|
|
| IGF1Rtide | KKKSPGEYVNIEFG | IGF1R, FGFR1 | IRS-1 derived peptide | Price
£25.00
|
|
| IKK Substrate Peptide | LDDRHDSGLDSMKDEEY | IKK | IkappaB alpha derived peptide | Price
£25.00
|
|
| IKK, TBK1 Substrate Peptide | KKKERLLDDRHDSGLDSMKDEE | IKK, TBK1 | IkappaB alpha derived peptide | Price
£25.00
|
|
| KEMPtide | LRRASLG | PKA | Price
£25.00
|
||
| LBKtide | LSNLYHQGKFLQTFCGSPLYRRR | LBK1 | NUAK2 derived peptide | Price
£25.00
|
|
| LKB1 Substrate Peptide | FGNFYKSGEPLSTWCGSPPYRRR | LKB1 | Price
£25.00
|
||
| Long S6 | KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK | RSK1, PRK2, ROCK | S6 derived peptide | Price
£25.00
|
|
| LRRKtide | RLGRDKYKTLRQIRQ | LRRK2, MAP4K3 | Moesin derived peptide | Price
£25.00
|
|
| Lyntide | EFPIYDFLPAKKK | Lyn, TEC | Price
£25.00
|
||
| MLCK Substrate Peptide | KKRPQRATSNVFA | MLCK | myosin regulatory light chain derived peptide | Price
£25.00
|
|
| NEK2a Substrate Peptide | RFRRSRRMI | NEK2A | Price
£25.00
|
||
| p70 S6 Kinase Substrate Peptide | KKRNRTLTV | p70 S6 kinase | Price
£25.00
|
||
| PAKtide | RRRLSFAEPG | PAKs, Aurora | Price
£25.00
|
||
| PDKtide | KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC | PDK1, JAK2 | residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984) | Price
£25.00
|
|
| PhKtide | KRKQISVRGL | Phosphorylase Kinase | glycogen phosphorylase derived peptide | Price
£25.00
|

