Recombinant Protein - NSP5 SARS-CoV2

Name: NSP5 SARS-CoV2
Price per aliquot (100µg): £110.00
Long Name:
NSP5 (1 - 306) SARS-CoV2
Synonyms:
SARS-CoV2-NSP5, SARS-CoV-2 NSP5, NSP5 SARS-CoV-2, 3CLPro, 3CL-Pro
Catalog Number (DU Number):
DU 67832
Accession:
QHD43415.1
Expression:
bacteria
Tag and Terminus:
N-Term
GST
Cleaved

C-Term
6His
Cleaved
Purification Method:
Cobalt Agarose
Calculated molecular mass:
Mono-Isotopic Mass: 33, 796.64 daltons after tag cleavage
Average Mass: 33, 774.50 daltons after tag cleavage
Purity:
90 %
Storage Buffer:
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
Storage Temperature:
-70 °C
Theoretical PI:
5.95
Gel Information :
  • Gel Image 1: 
Native Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ Amino acids S1 – Q306 (end). Residue S237 of the fusion protein is equivalent to S1 of the native enzyme. The GST tag is located at residues 1 – 220 and the His6 tag is located at residues 545– 550. Has C-terminal 5’ residues of NSP4 (residues 232 – 236) between PreScission site and N-terminus of NSP5 – corresponding to the cleavage site between NSP4 and NSP5 in the polyprotein of the SARS CoV virus to generate an authentic N-terminus during gene expression. The C-terminus encodes for a modified PreScission cleavage site before the His6 tag to generate an authentic C-terminus when cleaved, SGVTFQGP, residues 537 - 544.
Protease Cleavage:
Modified PreScission - SGVTFQGP, residues 537 - 544

Do you need any help? Please get in touch and we’ll be happy to lend a hand.