Recombinant Protein - E Protein MERS-CoV HSZ-Cc

Name: E Protein MERS-CoV HSZ-Cc
Price per aliquot (100µg): £110.00
Long Name:
Envelope Protein (1 - 75) MERS-CoV HSZ-Cc
Synonyms:
MERS-CoV-HSZ-Cc-E Protein, E Protein MERS-CoV-HSZ-Cc, Envelope Protein MERS-CoV-HSZ-Cc, MERS-CoV HSZ-Cc Envelope Protein
Catalog Number (DU Number):
DU 68500
Accession:
AGV08472.1
Expression:
bacteria
Tag and Terminus:
N-Term
MBP
Uncleaved
Purification Method:
Amylose Resin
Calculated molecular mass:
Mono-Isotopic Mass: 53, 559.22 daltons
Average Mass: 53, 595.15 daltons
Purity:
85 %
Storage Buffer:
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
Storage Temperature:
-70 °C
Theoretical PI:
4.93
Gel Information :
  • Gel Image 1: 
Native Sequence:
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELVKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGDDDDKVPEFLEVLFQGPLGSMLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCMTGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV Amino acids M1 – V82 (end). Residue M404 of the fusion protein is equivalent to M1 of the native enzyme. The MBP tag is located at residues 1 – 367.
Protease Cleavage:
PreScission (LEVLFQGP) residues 393 – 400

Do you need any help? Please get in touch and we’ll be happy to lend a hand.