MERS-CoV Recombinant Protein - M Protein MERS-CoV HSZ-Cc

Name: M Protein MERS-CoV HSZ-Cc
Price per aliquot (100µg): £125.00
Long Name:
Membrane Protein (1 - 219) MERS-CoV HSZ-Cc
Synonyms:
MERS-CoV HSZ-Cc M Protein, M Protein MERS-CoV HSZ-Cc, Membrane Protein MERS-CoV HSZ-Cc, MERS-CoV HSZ-Cc Membrane Protein
Species:
MERS-CoV
Catalog Number (DU Number):
DU67702
Accession:
ATY74387.1
Expression:
bacteria
Tag and Terminus:
N-Term
GST
Uncleaved
Purification Method:
GSH-Agarose
Calculated molecular mass:
Mono-Isotopic Mass: 51, 319.38 daltons
Average Mass: 51, 353.06 daltons
Purity:
65 %
Storage Buffer:
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
Storage Temperature:
-70 °C
Theoretical PI:
7.10
Gel Information :
  • Gel Image 1: 
Native Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMTVYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLFMRTGSWWSFNPETNCLLNVPIGGTIVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDYDRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLRA Amino acids M1 – A219 (end). Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage:
PreScission (LEVLFQGP) residues 221 - 228

Do you need any help? Please get in touch and we’ll be happy to lend a hand.