Recombinant Protein - N Protein Human CoV 229E

Name: N Protein Human CoV 229E
Price per aliquot (100µg): £110.00
Long Name:
Nucleocapsid Protein (1 - 389) Human CoV 229E
Synonyms:
Human CoV 229E N Protein, Human CoV 229E Nucleocapsid Protein
Catalog Number (DU Number):
DU 67703
Accession:
NP_073556.1
Expression:
bacteria
Tag and Terminus:
N-Term
GST
Uncleaved
Purification Method:
GSH-Agarose
Calculated molecular mass:
Mono-Isotopic Mass: 70, 246.91 daltons
Average Mass: 70, 290.93 daltons
Purity:
80 %
Storage Buffer:
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
Storage Temperature:
-70 °C
Theoretical PI:
9.03
Gel Information :
  • Gel Image 1: 
Native Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN Amino acids M1 – N389 (end). Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage:
PreScission (LEVLFQGP) residues 221 - 228

Do you need any help? Please get in touch and we’ll be happy to lend a hand.