Recombinant Protein - ORF9B SARS-CoV2

Name: ORF9B SARS-CoV2
Price per aliquot (100µg): £110.00
Long Name:
ORF9B (1 - 73) SARS-CoV2
Synonyms:
SARS-CoV2-ORF9B, SARS-CoV-2 ORF9B, ORF9B SARS-CoV-2
Catalog Number (DU Number):
DU 68493
Accession:
MN908947.3
Expression:
bacteria
Tag and Terminus:
N-Term
GST
Uncleaved
Purification Method:
GSH-Agarose
Calculated molecular mass:
Mono-Isotopic Mass: 34, 850.79 daltons
Average Mass: 34, 873.82 daltons
Purity:
80 %
Storage Buffer:
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
Storage Temperature:
-70 °C
Theoretical PI:
5.75
Gel Information :
  • Gel Image 1: 
Native Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMLQSCYNFLKEQHCQKASTQKGAEAAVKPLLVPHHVVATVQEIQLQAAVGELLLLEWLAMAVMLLLLCCCLTD Amino acids M1 – D73 (end). Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage:
PreScission (LEVLFQGP) residues 221 - 228

Do you need any help? Please get in touch and we’ll be happy to lend a hand.