Recombinant Protein - NSP16 SARS-CoV2

Name: NSP16 SARS-CoV2
Price per aliquot (100µg): £110.00
Long Name:
NSP16 (1 - 298) SARS-CoV2
Synonyms:
SARS-CoV2-NSP16, SARS-CoV-2 NSP16, NSP16 SARS-CoV-2
Catalog Number (DU Number):
DU 66420
Accession:
QHD43415.1
Expression:
bacteria
Tag and Terminus:
N-Term
GST
Uncleaved
Purification Method:
GSH-Agarose
Calculated molecular mass:
Mono-Isotopic Mass: 60, 108.39 daltons
Average Mass: 60, 147.49 daltons
Purity:
90 %
Storage Buffer:
50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
Storage Temperature:
-70 °C
Theoretical PI:
6.29
Gel Information :
  • Gel Image 1: 
Native Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN Amino acids S1 – N298 (end). Residue S232 of the fusion protein is equivalent to S1 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage:
PreScission (LEVLFQGP) residues 221 - 228

Do you need any help? Please get in touch and we’ll be happy to lend a hand.