Human Recombinant Protein - HOIL1 [C460A]

Name: HOIL1 [C460A]
Price per aliquot (100µg): £125.00
Long Name:
RanBP-type and C3HC4-type zinc finger-containing protein 1
Synonyms:
RBCK1
Species:
Human
Catalog Number (DU Number):
DU29715
Accession:
Q9BYM8
Expression:
bacteria
Tag and Terminus:
N-Term
6His
Uncleaved
Purification Method:
Ni-NTA agarose purification
Average Mass: 61154.50
Purity:
90%
Storage Buffer:
PBS, 1mM DTT
Storage Temperature:
-80ºC
Theoretical PI:
5.64
Gel Information :
  • Gel Image 1: 
    Gel 1 Text: 
    Lane 1 Marker See Blue Plus Lane 2 His-HOIL1 [C460A] AX428
Native Sequence:
MGSSHHHHHHSSGLEVLFQGPGSPEFPGVDSKAAAMDEKTKKAEEMALSL TRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQ MHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLH SHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPR GPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEM CCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQH VQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRN SQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRS AFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQMNCKEYQ EDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGADWIRC TVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH
Protease Cleavage:
RV-3C
Cloning Sites:
flanked Not1 Not1

Do you need any help? Please get in touch and we’ll be happy to lend a hand.