Human Recombinant Protein - HOIL1 [C506S]

Name: HOIL1 [C506S]
Price per aliquot (100µg): £125.00
Long Name:
RanBP-type and C3HC4-type zinc finger-containing protein 1
Synonyms:
RBCK1
Species:
Human
Catalog Number (DU Number):
DU29601
Accession:
Q9BYM8
Expression:
bacteria
Tag and Terminus:
N-Term
GST
Uncleaved
Purification Method:
GST-tag purification
Average Mass: 85358.86
Notes:
Hard to express. Tendency for premature termination of mRNA translation.
Purity:
30%
Storage Buffer:
50mM HEPES pH 7.5, 150mM NaCl, 10% glycerol, 1mM DTT, 10mM GSH
Storage Temperature:
-80ºC
Theoretical PI:
5.60
Gel Information :
  • Gel Image 1: 
    Gel 1 Text: 
    Lane 1 Marker See Blue Plus Lane 2 GST-HOIL1 [C506S] AX407
Native Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPGIPGSTRAAAMDEKTKKA EEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLW VSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLA RDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFK DLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKP TRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQ EGNYLQHVQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLHTFCREC LQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGI SIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQ MNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKD GCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSSQN CH*
Protease Cleavage:
RV-3C
Cloning Sites:
flanked Not1 Not1

Do you need any help? Please get in touch and we’ll be happy to lend a hand.