cDNA Clone - SARS-CoV2 (2019-nCoV) Nsp14

Name: SARS-CoV2 (2019-nCoV) Nsp14
Price per aliquot: £125.00
Expressed:
14His-SUMO-Nsp14 D331A
Plasmid:
pRF064 (14His-SUMO-Nsp14 D331A)
Parental Plasmid:
K27SUMO (see notes)
View Parent Plasmid

|
DU Number:
DU70488
Genbank:
Species:
SARS-CoV-2
Sequence of Insert:
View Sequence

see snapgene file
Amino Acid Sequence:
View Sequence

MSKHHHHSGHHHTGHHHHSGSHHHTGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQAD QTPEDLDMEDNDIIEAHREQIGGAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITRE EAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNL SDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMT RCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADKFPVLHAIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKF TDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRC NLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ*
Bacterial Selection:
Kan
Low Growth Temperature Requirement?:
No
Comments:
Clone made and deposited by Karim Labib lab. Backbone plasmid: K27SUMO (https://www.sciencedirect.com/science/article/pii/S009286741401040X)

Do you need any help? Please get in touch and we’ll be happy to lend a hand.