cDNA Clone - SARS-CoV-2 Nsp8

Name: SARS-CoV-2 Nsp8
Price per aliquot: £110.00
Expressed:
HA SARS-CoV-2 Nsp8
Plasmid:
pcDNA5 FRT/TO HA SARS CoV-2 Nsp8
Parent Plasmid:
pcDNA5 FRT/TO HA
View Parent Plasmid

|
DU Number:
DU67890
Genbank:
Species:
SARS-CoV-2
Sequence of Insert:
View Sequence

ggatccGCGATTGCGAGCGAATTTAGCAGCCTGCCGAGCTATGCGGCGTTTGCGACCGCGCAGGAAGCGTATGAACAGGCGGTGGCGAACGGCGATAGCGAAGTGGTGCTGAAAAAACTGAAAAAAAGCCTGAACGTGGCGAAAAGCGAATTTGATCGCGATGCGGCGATGCAGCGCAAACTGGAAAAAATGGCGGATCAGGCGATGACCCAGATGTATAAACAGGCGCGCAGCGAAGATAAACGCGCGAAAGTGACCAGCGCGATGCAGACCATGCTGTTTACCATGCTGCGCAAACTGGATAACGATGCGCTGAACAACATTATTAACAACGCGCGCGATGGCTGCGTGCCGCTGAACATTATTCCGCTGACCACCGCGGCGAAACTGATGGTGGTGATTCCGGATTATAACACCTATAAAAACACCTGCGATGGCACCACCTTTACCTATGCGAGCGCGCTGTGGGAAATTCAGCAGGTGGTGGATGCGGATAGCAAAATTGTGCAGCTGAGCGAAATTAGCATGGATAACAGCCCGAACCTGGCGTGGCCGCTGATTGTGACCGCGCTGCGCGCGAACAGCGCGGTGAAACTGCAGtgagcggccgc
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGSAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQ TMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTA LRANSAVKLQ*
Antibiotic:
Amp
Comments:
Codon optimised for bacterial expression.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.