cDNA Clone - SARS-CoV2 (2019-nCoV) NSP11/12

Name: SARS-CoV2 (2019-nCoV) NSP11/12
Price per aliquot: £110.00
Expressed:
GST 3C SARS-CoV-2 NSP11/12
Plasmid:
pGEX6P1 SARS-CoV-2 NSP11/12
Parent Plasmid:
pGEX6P1
View Parent Plasmid

Snapgene File | Genbank File
ACGTTATCGACTGCACGGTGCACCAATGCTTCTGGCGTCAGGCAGCCATCGGAAGCTGTGGTATGGCTGTGCAGGTCGTAAATCACTGCATAATTCGTGTCGCTCAAGGCGCACTCCCGTTCTGGATAATGTTTTTTGCGCCGACATCATAACGGTTCTGGCAAATATTCTGAAATGAGCTGTTGACAATTAATCATCGGCTCGTATAATGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGTATTCATGTCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCACTCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATGAGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTGGAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACAGTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTGGTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTGGATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAACTCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCGAAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCATCCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCCAATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTGAAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCATGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCCAAAATCGGATCTGGAAGTTCTGTTCCAGGGGCCCCTGGGATCCCCGGAATTCCCGGGTCGACTCGAGCGGCCGCATCGTGACTGACTGACGATCTGCCTCGCGCGTTTCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACGGTCACAGCTTGTCTGTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGGCGCGTCAGCGGGTGTTGGCGGGTGTCGGGGCGCAGCCATGACCCAGTCACGTAGCGATAGCGGAGTGTATAATTCTTGAAGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGGTTTCTTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATAAATTCCGACACCATCGAATGGTGCAAAACCTTTCGCGGTATGGCATGATAGCGCCCGGAAGAGAGTCAATTCAGGGTGGTGAATGTGAAACCAGTAACGTTATACGATGTCGCAGAGTATGCCGGTGTCTCTTATCAGACCGTTTCCCGCGTGGTGAACCAGGCCAGCCACGTTTCTGCGAAAACGCGGGAAAAAGTGGAAGCGGCGATGGCGGAGCTGAATTACATTCCCAACCGCGTGGCACAACAACTGGCGGGCAAACAGTCGTTGCTGATTGGCGTTGCCACCTCCAGTCTGGCCCTGCACGCGCCGTCGCAAATTGTCGCGGCGATTAAATCTCGCGCCGATCAACTGGGTGCCAGCGTGGTGGTGTCGATGGTAGAACGAAGCGGCGTCGAAGCCTGTAAAGCGGCGGTGCACAATCTTCTCGCGCAACGCGTCAGTGGGCTGATCATTAACTATCCGCTGGATGACCAGGATGCCATTGCTGTGGAAGCTGCCTGCACTAATGTTCCGGCGTTATTTCTTGATGTCTCTGACCAGACACCCATCAACAGTATTATTTTCTCCCATGAAGACGGTACGCGACTGGGCGTGGAGCATCTGGTCGCATTGGGTCACCAGCAAATCGCGCTGTTAGCGGGCCCATTAAGTTCTGTCTCGGCGCGTCTGCGTCTGGCTGGCTGGCATAAATATCTCACTCGCAATCAAATTCAGCCGATAGCGGAACGGGAAGGCGACTGGAGTGCCATGTCCGGTTTTCAACAAACCATGCAAATGCTGAATGAGGGCATCGTTCCCACTGCGATGCTGGTTGCCAACGATCAGATGGCGCTGGGCGCAATGCGCGCCATTACCGAGTCCGGGCTGCGCGTTGGTGCGGATATCTCGGTAGTGGGATACGACGATACCGAAGACAGCTCATGTTATATCCCGCCGTCAACCACCATCAAACAGGATTTTCGCCTGCTGGGGCAAACCAGCGTGGACCGCTTGCTGCAACTCTCTCAGGGCCAGGCGGTGAAGGGCAATCAGCTGTTGCCCGTCTCACTGGTGAAAAGAAAAACCACCCTGGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGGATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCGCTTTGCCTGGTTTCCGGCACCAGAAGCGGTGCCGGAAAGCTGGCTGGAGTGCGATCTTCCTGAGGCCGATACTGTCGTCGTCCCCTCAAACTGGCAGATGCACGGTTACGATGCGCCCATCTACACCAACGTAACCTATCCCATTACGGTCAATCCGCCGTTTGTTCCCACGGAGAATCCGACGGGTTGTTACTCGCTCACATTTAATGTTGATGAAAGCTGGCTACAGGAAGGCCAGACGCGAATTATTTTTGATGGCGTTGGAATT
DU Number:
DU67850
Genbank:
Species:
SARS-CoV-2
Sequence of Insert:
View Sequence

GGATCCAACCGCGTGTGCGGCGTGAGCGCGGCGCGCCTGACCCCGTGCGGCACCGGCACCAGCACCGATGTGGTGTATCGCGCGTTTGATATTTATAACGATAAAGTGGCGGGCTTTGCGAAATTTCTGAAAACCAACTGCTGCCGCTTTCAGGAAAAAGATGAAGATGATAACCTGATTGATAGCTATTTTGTGGTGAAACGCCATACCTTTAGCAACTATCAGCATGAAGAAACCATTTATAACCTGCTGAAAGATTGCCCGGCGGTGGCGAAACATGATTTTTTTAAATTTCGCATTGATGGCGATATGGTGCCGCATATTAGCCGCCAGCGCCTGACCAAATATACCATGGCGGATCTGGTGTATGCGCTGCGCCATTTTGATGAAGGCAACTGCGATACCCTGAAAGAAATTCTGGTGACCTATAACTGCTGCGATGATGATTATTTTAACAAAAAAGATTGGTATGATTTTGTGGAAAACCCGGATATTCTGCGCGTGTATGCGAACCTGGGCGAACGCGTGCGCCAGGCGCTGCTGAAAACCGTGCAGTTTTGCGATGCGATGCGCAACGCGGGCATTGTGGGCGTGCTGACCCTGGATAACCAGGATCTGAACGGCAACTGGTATGATTTTGGCGATTTTATTCAGACCACCCCGGGCAGCGGCGTGCCGGTGGTGGATAGCTATTATAGCCTGCTGATGCCGATTCTGACCCTGACCCGCGCGCTGACCGCGGAAAGCCATGTGGATACCGATCTGACCAAACCGTATATTAAATGGGATCTGCTGAAATATGATTTTACCGAAGAACGCCTGAAACTGTTTGATCGCTATTTTAAATATTGGGATCAGACCTATCATCCGAACTGCGTGAACTGCCTGGATGATCGCTGCATTCTGCATTGCGCGAACTTTAACGTGCTGTTTAGCACCGTGTTTCCGCCGACCAGCTTTGGCCCGCTGGTGCGCAAAATTTTTGTGGATGGCGTGCCGTTTGTGGTGAGCACCGGCTATCATTTTCGCGAACTGGGCGTGGTGCATAACCAGGATGTGAACCTGCATAGCAGCCGCCTGAGCTTTAAAGAACTGCTGGTGTATGCGGCGGAcCCGGCGATGCATGCGGCGAGCGGCAACCTGCTGCTGGATAAACGCACCACCTGCTTTAGCGTGGCGGCGCTGACCAACAACGTGGCGTTTCAGACCGTGAAACCGGGCAACTTTAACAAAGATTTTTATGATTTTGCGGTGAGCAAAGGCTTTTTTAAAGAAGGCAGCAGCGTGGAACTGAAACATTTTTTTTTTGCGCAGGATGGCAACGCGGCGATTAGCGATTATGATTATTATCGCTATAACCTGCCGACCATGTGCGATATTCGCCAGCTGCTGTTTGTGGTGGAAGTGGTGGATAAATATTTTGATTGCTATGATGGCGGCTGCATTAACGCGAACCAGGTGATTGTGAACAACCTGGATAAAAGCGCGGGCTTTCCGTTTAACAAATGGGGCAAAGCGCGCCTGTATTATGATAGCATGAGCTATGAAGATCAGGATGCGCTGTTTGCGTATACCAAACGCAACGTGATTCCGACCATTACCCAGATGAACCTGAAATATGCGATTAGCGCGAAAAACCGCGCGCGCACCGTGGCGGGCGTGAGCATTTGCAGCACCATGACCAACCGCCAGTTTCATCAGAAACTGCTGAAAAGCATTGCGGCGACCCGCGGCGCGACCGTGGTGATTGGCACCAGCAAATTTTATGGCGGCTGGCATAACATGCTGAAAACCGTGTATAGCGATGTGGAAAACCCGCATCTGATGGGCTGGGATTATCCGAAATGCGATCGCGCGATGCCGAACATGCTGCGCATTATGGCGAGCCTGGTGCTGGCGCGCAAACATACCACCTGCTGCAGCCTGAGCCATCGCTTTTATCGCCTGGCGAACGAATGCGCGCAGGTGCTGAGCGAAATGGTGATGTGCGGCGGCAGCCTGTATGTGAAACCGGGCGGCACCAGCAGCGGCGATGCGACCACCGCGTATGCGAACAGCGTGTTTAACATTTGCCAGGCGGTGACCGCGAACGTGAACGCGCTGCTGAGCACCGATGGCAACAAAATTGCGGATAAATATGTGCGCAACCTGCAGCATCGCCTGTATGAATGCCTGTATCGCAACCGCGATGTGGATACCGATTTTGTGAACGAATTTTATGCGTATCTGCGCAAACATTTTAGCATGATGATTCTGAGCGATGATGCGGTGGTGTGCTTTAACAGCACCTATGCGAGCCAGGGCCTGGTGGCGAGCATTAAAAACTTTAAAAGCGTGCTGTATTATCAGAACAACGTGTTTATGAGCGAAGCGAAATGCTGGACCGAAACCGATCTGACCAAAGGCCCGCATGAATTTTGCAGCCAGCATACCATGCTGGTGAAACAGGGCGATGATTATGTGTATCTGCCGTATCCGGAcCCGAGCCGCATTCTGGGCGCGGGCTGCTTTGTGGATGATATTGTGAAAACCGATGGCACCCTGATGATTGAACGCTTTGTGAGCCTGGCGATTGATGCGTATCCGCTGACCAAACATCCGAACCAGGAATATGCGGATGTGTTTCATCTGTATCTGCAGTATATTCGCAAACTGCATGATGAACTGACCGGCCATATGCTGGATATGTATAGCGTGATGCTGACCAACGATAACACCAGCCGCTATTGGGAACCGGAATTTTATGAAGCGATGTATACCCCGCATACCGTGCTGCAGtgaGCGGCCGC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTF SNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYAN LGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTE ERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAAD PAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVD KYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLK SIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKP GGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVA SIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEY ADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No
Comments:
Codon optimised for bacterial expression.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.