cDNA Clone - (mu) MYCBP2

Name: (mu) MYCBP2
Price per aliquot: £125.00
Expressed:
Mouse Mycbp2
Plasmid:
pSc-B-(mu)MYCBP2 nt 4155 - 6292
Parental Plasmid:
pSC-B
View Parent Plasmid

Snapgene File | Genbank File
ATGACCATGATTACGCCAAGCGCGCAATTAACCCTCACTAAAGGGAACAAAAGCTGGGTACCGGGCCCCCCCTCGAGGTCGACGGTATCGATAAGCTTGATATCCACTGTGGAATTCGCCCTTAAGGGCGAATTCCACATTGGTCGCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCACCGCGGGAGCTCCAATTCGCCCTATAGTGAGTCGTATTACGCGCGCTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATTAAATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAGTCAGAAGAACTCGTCAAGAAGGCGATAGAAGGCGATGCGCTGCGAATCGGGAGCGGCGATACCGTAAAGCACGAGGAAGCGGTCAGCCCATTCGCCGCCAAGTTCTTCAGCAATATCACGGGTAGCCAACGCTATGTCCTGATAGCGGTCCGCCACACCCAGCCGGCCACAGTCGATGAATCCAGAAAAGCGGCCATTTTCCACCATGATATTCGGCAAGCAGGCATCGCCATGGGTCACGACGAGATCCTCGCCGTCGGGCATGCTCGCCTTGAGCCTGGCGAACAGTTCGGCTGGCGCGAGCCCCTGATGTTCTTCGTCCAGATCATCCTGATCGACAAGACCGGCTTCCATCCGAGTACGTGCTCGCTCGATGCGATGTTTCGCTTGGTGGTCGAATGGGCAGGTAGCCGGATCAAGCGTATGCAGCCGCCGCATTGCATCAGCCATGATGGATACTTTCTCGGCAGGAGCAAGGTGAGATGACAGGAGATCCTGCCCCGGCACTTCGCCCAATAGCAGCCAGTCCCTTCCCGCTTCAGTGACAACGTCGAGCACAGCTGCGCAAGGAACGCCCGTCGTGGCCAGCCACGATAGCCGCGCTGCCTCGTCTTGCAGTTCATTCAGGGCACCGGACAGGTCGGTCTTGACAAAAAGAACCGGGCGCCCCTGCGCTGACAGCCGGAACACGGCGGCATCAGAGCAGCCGATTGTCTGTTGTGCCCAGTCATAGCCGAATAGCCTCTCCACCCAAGCGGCCGGAGAACCTGCGTGCAATCCATCTTGTTCAATCATTAGTGTCCTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTTAATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGGACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTAGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGTCTATTCTTTTGATTTACAGTTAATTAAAGGGAACAAAAGCTGGCATGTACCGTTCGTATAGCATACATTATACGAACGGTACGCTCCAATTCGCCCTTTAATTAACTGTTCCAACTTTCACCATAATGAAATAAGATCACTACCGGGCGTATTTTTTGAGTTGTCGAGATTTTCAGGAGCTAAGGAAGCTAAAATGGAGAAAAAAATCACTGGATATACCACCGAGTACTGCGATGAGTGGCAGGGCGGGGCGTAATTTTTTTAAGGCAGTTATTGGTGCCCTTAAACGCCTGGTTGCTACGCCTGAATAAGTGATAATAAGCGGATGAATGGCAGAAATTCGAAAGCAAATTCGACCCGGTCGTCGGTTCAGGGCAGGGTCGTTAAATAGCCGCTTATGTCTATTGCTGGTTTACCGGTTTATTGACTACCGGAAGCAGTGTGACCGTGTGCTTCTCAAATGCCTGAGGCCAGTTTGCTCAGGCTCTCCCCGTGGAGGTAATAATTGACGATATGATCCTTTTTTTCTGATCAAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTTCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTCCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCT
DU Number:
DU65484
Species:
Mouse
Sequence of Insert:
View Sequence

GGTACCGATGTAAATGCTGGTCAGATACCTCAACTGTTATACAGACTCCC GACCAGTGACGGCAGTACCTCAAAAGGCAAGCAGCAAACGAGTGAGCCTG TCCACATCTTAAAGAGGTCTTTTGCAAGAACTGTCTCCGTGGAGTGCTTC GAGTCGCTGCTGAGCATTCTTCACTGGAGCTGGACCACCTTAGTCTTAGG AGTGGAAGAGCTCAGGGGGCTGAAAGGGTTCCAGTTCACCGCTACACTCC TTGACTTAGAGCGGCTGCGCTTCGTGGGCACCTGTTGTCTGCGGTTACTG CGCGTCTACACCTGTGAGATATACCCAGTATCAGCTACAGGAAAAGCAGT TGTTGAAGAAACTAGCAAATTAGCTGAGTGTATTGGAAAAACAAGAACTT TGTTAAGAAAAATCTTATCGGAAGGAGTTGATCATTGCATGGTGAAGTTG GATAATGACCCTCAGGGATACCTCAGCCAGCCCCTGAGGCTACTAGAAGC TGTGCTTCAGGAGTGCCACAACACCTTCACCGCCTGCTTTCACTCCTTCT ACCCAACGCCGGCACTACAGTGGGCATGCCTCTGTGATCTGCTCAATTGC CTGGATCAGGATATCCAGGAAGCAAACTTTAAGACGTCAAGTAGCCGGCT CCTTGCAGCTGTCATGTCAGCTCTGTGTCACACTTCTGTGAAGCTGACTT CTCTCTTCCCTATTGCATACGATGGAGAAGTGTTGCTGCGATCGATTGTT AAGCAAGTCAGCACGGAGAACGACTCAACACTAGTTCATCGTTTTCCACT TTTAGTGGGACATATGGAAAAGCTCAGCCAGAGTGAAGAGAACATCTCCG GCATGACGAGCTTCCGGGAAGTGCTGGAGAAGATGCTGGTCATTGTTGTG CTTCCAGTGAGAAACAGCCTTCGGAGGGAGAGTGAGCTCTTCTCCTCTCA CCTGGTCTCCAACACCTGCGGACTGCTGGCCAGCATTGTCAGTGAGCTGA CTGCATCAGCCCTCGGGTCGGAGGTTGATGGACTTAATTCTCTTCACTCT GTCAAAGCCAGTGCTAACCGATTCACAAAAACAAGTCAGGGAAGAAGTTG GAACACTGGAAATGGGTCCCCTGATGCAATCTGTTTTGCAGTCGACAAAC CTGGAATTGTGGTTGTTGGTTTCGCTGTCTATGGAGGAGGCGGCATCCAT GAGTATGAGCTGGAGGTGTTGGTTGATGATAGTGAACATGCAGGAGATTC AACTCATTCTCATAGATGGACGTCTCTAGAATTAGTTAAAGGAACTTATA CAACAGACGATTCACCCAGTGACATAGCTGAAATCAGACTTGACAAAGTT GTTCCCTTAAAGGAAAATGTTAAGTATGCTGTGCGCTTGAGGAACTATGG CAGTCGCACAGCCAATGGAGATGGAGGGATGACCACTGTTCAGTGCCCTG ATGGAGTGACCTTTACCTTCAGCACATGCAGCTTGAGCAGTAATGGCACA AACCAAACCAGAGGACAGATTCCCCAGATACTATACTATAGGAGTGAATT TGATGGAGATTTACAATCCCAACTTCTAAGTAAAGCTAATGAAGAAGATA AAAACTGTAGCAGAGCACTCTCTGTGGTAAGCACTGTTGTTCGAGCTGCG AAGGACCTGTTGCACAGAGCTCTTGCTGTGGATGCTGATGACATTCCAGA ACTGCTTAGCTCTTCCAGTCTGTTTTCCATGCTGCTTCCCCTTATTATAG CCTACATAGGACCAGTAGCCGCTGCTATTCCCAAGGTTGCTGTAGAAGTT TTTGGCCTTGTCCAGCAATTGCTTCCCTCAGTTGCCATTTTGAATCAGAA GTATGCACCCCCTGCGTTCAATCCCAATCAGTCAACTGATAGTACGACAG GCAACCAGCCCGAGCAAGGCCTCTCAGCTTGTACCACTTCCAATCACTAT GCTGTCATTGAGAGTGAGCACCCATACAAGCCTGCCTGTGTGATGCACTA CAAGGTGACATTCCCAGAATGTGTTAGGTGGATGACAATCGAATTTGACC CTCAGTGTGGTACTGCACAGTCAGAAGACGTCATCCGTTTGCTTATTCCT GTCAGAACCATTCAGAACTCTGGATATGGAGCAAAACTGACATCTGTTCA TGAAAACCTTAATTCATGGGTAGAATTAAAGAAATATTCAGGATCC
Amino Acid Sequence:
View Sequence

GTDVNAGQIPQLLYRLPTSDGSTSKGKQQTSEPVHILKRSFARTVSVECF ESLLSILHWSWTTLVLGVEELRGLKGFQFTATLLDLERLRFVGTCCLRLL RVYTCEIYPVSATGKAVVEETSKLAECIGKTRTLLRKILSEGVDHCMVKL DNDPQGYLSQPLRLLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNC LDQDIQEANFKTSSSRLLAAVMSALCHTSVKLTSLFPIAYDGEVLLRSIV KQVSTENDSTLVHRFPLLVGHMEKLSQSEENISGMTSFREVLEKMLVIVV LPVRNSLRRESELFSSHLVSNTCGLLASIVSELTASALGSEVDGLNSLHS VKASANRFTKTSQGRSWNTGNGSPDAICFAVDKPGIVVVGFAVYGGGGIH EYELEVLVDDSEHAGDSTHSHRWTSLELVKGTYTTDDSPSDIAEIRLDKV VPLKENVKYAVRLRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGT NQTRGQIPQILYYRSEFDGDLQSQLLSKANEEDKNCSRALSVVSTVVRAA KDLLHRALAVDADDIPELLSSSSLFSMLLPLIIAYIGPVAAAIPKVAVEV FGLVQQLLPSVAILNQKYAPPAFNPNQSTDSTTGNQPEQGLSACTTSNHY AVIESEHPYKPACVMHYKVTFPECVRWMTIEFDPQCGTAQSEDVIRLLIP VRTIQNSGYGAKLTSVHENLNSWVELKKYSGS
Bacterial Selection:
Amp, Kan
Low Growth Temperature Requirement?:
No
Comments:
From native Kpn1 site at nt 4155 to native BamHI site at nt6292 Comprises GLY1371- Ser2099 of full-length protein. Clone harbours a 9bp insertion at nt 4720 (relative to full-length NCBI numbering) giving a 3 residue insertion (Asp-Ile-Gln) between Q1573 and E1574

Do you need any help? Please get in touch and we’ll be happy to lend a hand.