cDNA Clone - 14-3-3 zeta

Name: 14-3-3 zeta
Price per aliquot: £110.00
Expressed:
6His 14-3-3 zeta T215A
Plasmid:
pETBlue 6His 14-3-3 zeta T215A
Parent Plasmid:
pETBlue 6His
View Parent Plasmid

|
DU Number:
DU65463
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

CCATGGGACACCATCACCATCACCATCTGGAAGTTCTGTTCCAGGGGCCC GATAAAAATGAGCTGGTTCAGAAGGCCAAACTGGCCGAGCAGGCTGAGCG ATATGATGACATGGCAGCCTGCATGAAGTCTGTAACTGAGCAAGGAGCTG AATTATCCAATGAGGAGAGGAATCTTCTCTCAGTTGCTTATAAAAATGTT GTAGGAGCCCGTAGGTCATCTTGGAGGGTCGTCTCAAGTATTGAACAAAA GACGGAAGGTGCTGAGAAAAAACAGCAGATGGCTCGAGAATACAGAGAGA AAATTGAGACGGAGCTAAGAGATATCTGCAATGATGTACTGTCTCTTTTG GAAAAGTTCTTGATCCCCAATGCTTCACAAGCAGAGAGCAAAGTCTTCTA TTTGAAAATGAAAGGAGATTACTACCGTTACTTGGCTGAGGTTGCCGCTG GTGATGACAAGAAAGGGATTGTCGATCAGTCACAACAAGCATACCAAGAA GCTTTTGAAATCAGCAAAAAGGAAATGCAACCAACACATCCTATCAGACT GGGTCTGGCCCTTAACTTCTCTGTGTTCTATTATGAGATTCTGAACTCCC CAGAGAAAGCCTGCTCTCTTGCAAAGACAGCTTTTGATGAAGCCATTGCT GAACTTGATACATTAAGTGAAGAGTCATACAAAGACAGCGCGCTAATAAT GCAATTACTGAGAGACAACTTGACATTGTGGACATCGGATACCCAAGGAG ACGAAGCTGAAGCAGGAGAAGGAGGGGAAAATTAAGGATCC
Amino Acid Sequence:
View Sequence

MGHHHHHHLEVLFQGPDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAE LSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREK IETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAG DDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSP EKACSLAKTAFDEAIAELDTLSEESYKDSALIMQLLRDNLTLWTSDTQGD EAEAGEGGEN*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No

Do you need any help? Please get in touch and we’ll be happy to lend a hand.