cDNA Clone - (mu)RNF146

Name: (mu)RNF146
Price per aliquot: £110.00
Expressed:
GST-RNF146 (RING-WWE)
Plasmid:
pGEX-TEV-(mu)RNF146 Ala30-Arg183
Full Snapgene Map:
Parent Plasmid:
pGEX-TEV
View Parent Plasmid

|
DU Number:
DU65351
Genbank:
Species:
Mouse
Sequence of Insert:
View Sequence

GGATCCGCACCTTCTCTGACAGTTCCTGAATGTGCCATTTGTCTACAAACATGTGTTCACCCTGTCAGTCTGCCCTGTAAGCATGTTTTCTGTTATCTGTGTGTAAAGGGTGCTTCATGGCTTGGGAAGCGATGTGCTCTTTGTCGACAAGAGATTCCTGAGGATTTTCTTGACAAGCCAACCTTGTTGTCACCAGAAGAACTTAAGGCTGCAAGCAGAGGAAATGGTGAATATGCGTGGTATTATGAAGGAAGGAATGGGTGGTGGCAGTATGATGAGCGCACTAGTCGGGAGCTAGAAGATGCTTTTTCCAAAGGTAAAAAGAACACGGAAATGTTAATTGCTGGATTTCTGTATGTTGCTGATCTTGAAAACATGGTTCAATATAGGAGAAATGAACATGGACGTCGCAGGAAGATTAAGCGAGATATAATAGATATACCAAAGAAGGGAGTAGCTGGACTTAGGTAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDENLYFQGGSAPSLTVPECAICLQTCVHPVS LPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASR GNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADL ENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLR*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No
Comments:
Parental 20757 For more information please look into the biochemical assay in the following paper: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4289021/

Do you need any help? Please get in touch and we’ll be happy to lend a hand.