cDNA Clone - Rab29

Name: Rab29
Price per aliquot: £125.00
Expressed:
HA Rab29 mito (MAO tag)
Plasmid:
pBabeD Hygro HA Rab29 Mito (MAO tag)
Parental Plasmid:
pBabeD hygro HA
View Parent Plasmid

|
DU Number:
DU68114
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGGGCAGCCGCGACCACCTGTTCAAAGTGCTGGTGGTGGGGGACGCCGCAGTGGGCAAGACGTCGCTGGTGCAGCGATATTCCCAGGACAGCTTCAGCAAACACTACAAGTCCACGGTGGGAGTGGATTTTGCTCTGAAGGTTCTCCAGTGGTCTGACTACGAGATAGTGCGGCTTCAGCTGTGGGATATTGCAGGGCAGGAGCGCTTCACCTCTATGACACGATTGTATTATCGGGATGCCTCTGCCTGTGTTATTATGTTTGACGTTACCAATGCCACTACCTTCAGCAACAGCCAGAGGTGGAAACAGGACCTAGACAGCAAGCTCACACTACCCAATGGAGAGCCGGTGCCCTGCCTGCTCTTGGCCAACAAGTGTGATCTGTCCCCTTGGGCAGTGAGCCGGGACCAGATTGACCGGTTCAGTAAAGAGAACGGTTTCACAGGTTGGACAGAAACATCAGTCAAGGAGAACAAAAATATTAATGAGGCTATGAGAGTCCTCATTGAAAAGATGATGAGAAATTCCACAGAAGATATCATGTCTTTGTCCACCCAAGGGGACTACATCAATCTACAAACCAAGTCCTCCAGCTGGTCCGGTGCTGGCGCCGGTGCGGCCGCCTTCTGGGAAAGGAACCTGCCCTCTGTTTCTGGCCTGCTGAAGATCATTGGATTTTCCACATCAGTAACTGCCCTGGGGTTTGTGCTGTACAAATACAAGCTCCTGCCACGGTCTTGAGAATTC
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGSMGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSGAGAGAAAFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS*
Bacterial Selection:
Amp
Low Growth Temperature Requirement?:
No

Do you need any help? Please get in touch and we’ll be happy to lend a hand.