cDNA Clone - MYCBP2

Name: MYCBP2
Price per aliquot: £110.00
Expressed:
GST-MYCBP2 Ser4378-Phe4640 R4519A C4572S
Plasmid:
pGEX6P-1-MYCBP2 Ser4378-Phe4640 R4519A C4572S
Parent Plasmid:
pGEX6P-1
View Parent Plasmid

|
DU Number:
DU65203
Species:
Human
Sequence of Insert:
View Sequence

GGATCCAGTGCCACAAGCCTGAAGCAAGACGCCGATGACATGTGCATGAT ATGTTTCACCGAAGCGCTCTCGGCAGCACCAGCCATTCAGCTGGATTGTA GTCACATATTCCACTTACAGTGCTGTCGGCGAGTATTAGAAAATCGATGG CTTGGCCCAAGGATAACATTTGGATTTATATCTTGTCCCATTTGCAAGAA CAAAATTAATCACATAGTACTAAAAGACCTACTTGATCCAATAAAAGAAC TCTATGAGGATGTCAGAAGAAAAGCCTTAATGAGATTGGAATATGAAGGT CTGCATAAGAGTGAAGCTATCACAACTCCTGGTGTGAGGTTTTATAATGA CCCAGCTGGCTATGCAATGAATAGATATGCATATTATGTGTGCTACAAAT GCAGAAAGGCATATTTTGGTGGTGAAGCTgcCTGCGATGCTGAGGCTGGA CGGGGAGATGATTATGATCCCAGAGAGCTCATTTGTGGTGCCTGTTCTGA TGTTTCCAGGGCTCAGATGTGTCCCAAACATGGCACAGACTTTTTGGAAT ATAAATGTCGCTACTGCTGTTCAGTGGCTGTTTTTTTCTCTTTTGGAACA ACACATTTTTGTAATGCTTGTCATGATGATTTTCAAAGAATGACTAGCAT TCCTAAGGAAGAACTACCACACTGTCCTGCAGGTCCCAAAGGCAAGCAGT TAGAAGGAACTGAATGTCCACTCCATGTTGTTCATCCACCCACTGGGGAA GAGTTTGCTCTGGGATGTGGAGTGTGCAGAAATGCCCACACTTTTTAGGC GGCCGc
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSATSLKQDADDMCMICFTE ALSAAPAIQLDCSHIFHLQCCRRVLENRWLGPRITFGFISCPICKNKINH IVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDPAGY AMNRYAYYVCYKCRKAYFGGEAACDAEAGRGDDYDPRELICGACSDVSRA QMCPKHGTDFLEYKCRYCCSVAVFFSFGTTHFCNACHDDFQRMTSIPKEE LPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No

Do you need any help? Please get in touch and we’ll be happy to lend a hand.