cDNA Clone - 2x(6His)-ULK1

Name: 2x(6His)-ULK1
Price per aliquot: £110.00
Expressed:
2x(6His)-FLAG-ULK1
Plasmid:
pcDNA5-FRT/TO-2x(6His)-FLAG-ULK1
Parent Plasmid:
pcDNA5-FRT/TO
View Parent Plasmid

|
DU Number:
DU65171
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

ggatccATGcatcatcatcatcatcatagcagcggcctggtgccgcgcgg cagccatatggcgagccatcatcatcatcatcatcatcatcatcatggcg aaaacctgtattttcagggcATGGACTACAAGGACGATGACGATAAGgga tctATGGAGCCCGGCCGCGGCGGCACAGAGACCGTGGGCAAGTTCGAGTT CTCCCGCAAGGACCTGATCGGCCACGGCGCCTTCGCGGTGGTCTTCAAGG GCCGCCACCGCGAGAAGCACGATTTGGAGGTCGCCGTCAAGTGCATTAAC AAGAAGAACCTCGCCAAGTCTCAGACGCTGCTGGGGAAGGAAATCAAAAT CCTGAAGGAACTGAAACATGAAAACATCGTGGCCCTGTACGACTTCCAGG AAATGGCTAATTCTGTCTACCTGGTTATGGAGTACTGCAACGGTGGGGAC CTGGCCGACTACCTGCACGCCATGCGCACGCTGAGCGAGGACACCATCAG GCTCTTCCTGCAGCAGATCGCGGGCGCCATGCGGCTTCTGCACAGCAAAG GCATCATCCACCGCGACCTGAAACCGCAGAACATCCTGCTGTCCAACCCC GCCGGCCGCCGCGCCAACCCCAACAGCATCCGCGTCAAGATCGCTGACTT CGGCTTCGCGCGGTACCTCCAGAGCAACATGATGGCGGCCACACTCTGCG GCTCCCCCATGTACATGGCCCCCGAGGTCATCATGTCCCAGCACTACGAC GGGAAGGCGGACCTGTGGAGCATCGGCACCATCGTCTACCAGTGCCTGAC GGGGAAGGCGCCCTTCCAGGCCAGCAGCCCCCAGGACCTGCGCCTGTTCT ACGAGAAGAACAAGACGTTGGTCCCCACCATCCCCCGGGAGACCTCGGCC CCGCTGCGGCAGCTGCTCCTGGCCCTACTGCAACGCAACCACAAGGACCG CATGGACTTCGATGAGTTTTTTCATCACCCTTTCCTCGATGCCAGCCCCT CGGTCAGGAAATCCCCACCCGTGCCTGTGCCCTCGTACCCAAGCTCGGGG TCCGGCAGCAGCTCCAGCAGCAGCTCCACCTCCCACCTGGCCTCCCCGCC GTCCCTGGGCGAGATGCAGCAGCTGCAGAAGACCCTGGCCTCCCCGGCTG ACACCGCTGGCTTCCTGCACAGCTCCCGGGACTCTGGTGGCAGCAAGGAC TCTTCCTGTGACACAGATGACTTCGTCATGGTCCCCGCGCAGTTTCCAGG TGACCTGGTGGCTGAGGCGCCCAGTGCCAAACCCCCGCCAGACAGCCTGA TGTGCAGTGGGAGCTCACTGGTGGCCTCTGCGGGCTTGGAGAGCCACGGC CGGACCCCATCTCCATCCCCACCCTGCAGCAGCTCCCCCAGTCCCTCAGG CCGGGCTGGCCCGTTCTCCAGCAGCAGGTGCGGCGCCTCTGTCCCCATCC CAGTCCCCACGCAGGTGCAGAACTACCAGCGCATTGAGCGAAACCTGCAG TCACCCACCCAGTTCCAAACACCTCGGTCCTCTGCCATCCGCAGGTCAGG CAGCACCAGCCCCCTGGGCTTTGCAAGGGCCAGCCCCTCGCCCCCTGCCC ACGCTGAGCATGGAGGCGTCCTGGCCAGGAAGATGTCTCTGGGTGGAGGC CGGCCCTACACGCCATCTCCTCAAGTTGGAACCATCCCTGAGCGGCCAGG CTGGAGCGGGACGCCCTCCCCACAGGGAGCTGAGATGCGGGGTGGCAGGT CCCCTCGTCCAGGCTCCTCTGCACCCGAGCACTCTCCCCGCACTTCCGGG CTGGGCTGCCGCCTGCACAGCGCCCCCAACCTGTCTGACTTGCACGTCGT CCGCCCCAAGCTGCCCAAACCCCCCACGGACCCCCTGGGAGCTGTGTTCA GCCCACCACAGGCCAGCCCTCCCCAGCCGTCCCACGGCCTGCAGTCCTGC CGGAACCTGCGGGGCTCACCCAAGCTGCCCGACTTCCTGCAGCGAAACCC CCTGCCCCCCATCCTGGGCTCCCCCACCAAGGCTGTGCCCTCCTTTGACT TCCCGAAGACCCCCAGCTCCCAGAACCTGCTGGCCCTCCTAGCCCGGCAG GGCGTGGTGATGACGCCCCCTCGAAACCGGACGCTGCCCGACCTCTCGGA GGTGGGACCCTTCCATGGTCAGCCGTTGGGCCCTGGCCTGCGGCCAGGCG AGGACCCCAAGGGCCCCTTTGGCCGGTCTTTCAGCACCAGCCGCCTCACT GACCTGCTCCTTAAGGCGGCGTTTGGGACACAAGCCCCGGACCTGGGCAG CACGGAGAGCCTGCAGGAGAAGCCCATGGAGATCGCACCCTCAGCTGGCT TTGGAGGGAGCCTGCACCCAGGAGCCCGTGCTGGGGGCACCAGCAGCCCT TCCCCGGTGGTCTTCACCGTGGGCTCTCCCCCGAGCGGGAGCACGCCCCC CCAGGGCCCCCGCACCAGGATGTTCTCAGCGGGCCCCACTGGCTCTGCCA GCTCTTCTGCCCGCCACCTGGTGCCTGGGCCCTGCAGCGAGGCCCCAGCC CCTGAGCTCCCTGCTCCAGGACACGGCTGCAGCTTTGCCGACCCCATTGC TGCGAACCTGGAGGGGGCTGTGACCTTCGAGGCCCCCGACCTCCCTGAGG AGACCCTCATGGAGCAAGAGCACACGGAGATCCTGCGTGGCCTGCGCTTC ACGCTGCTGTTCGTGCAGCACGTCCTGGAGATCGCAGCCCTGAAGGGCAG CGCCAGTGAGGCGGCGGGGGGCCCTGAGTACCAGCTGCAGGAGAGTGTGG TGGCCGACCAGATCAGCCTGCTGAGCCGAGAATGGGGCTTCGCGGAACAG CTGGTGCTGTACCTGAAGGTGGCCGAGCTACTGTCCTCCGGCCTGCAAAG TGCCATCGACCAGATCCGGGCCGGCAAGCTCTGCCTGTCGTCCACTGTGA AGCAGGTGGTGCGCAGGCTGAATGAGCTGTACAAGGCCAGCGTGGTGTCC TGCCAGGGCCTGAGCCTGCGGCTGCAGCGCTTCTTCCTGGACAAGCAGCG GCTCCTGGACCGCATTCACAGCATCACTGCCGAGAGGCTCATCTTCAGCC ACGCTGTGCAGATGGTGCAGTCGGCTGCCCTGGACGAGATGTTCCAGCAC CGTGAGGGCTGCGTCCCACGCTACCACAAGGCCCTGCTGCTCCTGGAGGG GCTGCAGCACATGCTCTCGGACCAGGCCGACATCGAGAACGTCACCAAGT GCAAGCTGTGCATTGAGCGGAGACTCTCGGCGCTGCTGACTGGCATCTGT GCCTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MHHHHHHSSGLVPRGSHMASHHHHHHHHHHGENLYFQGMDYKDDDDKGSM EPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKK NLAKSQTLLGKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLA DYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPAG RRANPNSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGK ADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLVPTIPRETSAPL RQLLLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGSG SSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDSS CDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRT PSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQSP TQFQTPRSSAIRRSGSTSPLGFARASPSPPAHAEHGGVLARKMSLGGGRP YTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSAPEHSPRTSGLG CRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRN LRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGV VMTPPRNRTLPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDL LLKAAFGTQAPDLGSTESLQEKPMEIAPSAGFGGSLHPGARAGGTSSPSP VVFTVGSPPSGSTPPQGPRTRMFSAGPTGSASSSARHLVPGPCSEAPAPE LPAPGHGCSFADPIAANLEGAVTFEAPDLPEETLMEQEHTEILRGLRFTL LFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQLV LYLKVAELLSSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQ GLSLRLQRFFLDKQRLLDRIHSITAERLIFSHAVQMVQSAALDEMFQHRE GCVPRYHKALLLLEGLQHMLSDQADIENVTKCKLCIERRLSALLTGICA*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No
Comments:
Parental 41459 Grow at 30 degrees silent change c1065t and coding change c2141t (P714L) (exisiting SNP)

Do you need any help? Please get in touch and we’ll be happy to lend a hand.