cDNA Clone - (mu)FAM83H

Name: (mu)FAM83H
Price per aliquot: £125.00
Expressed:
GFP-(mu)Fam83H
Plasmid:
pcDNA5D-FRT/TO GFP-(mu)Fam83H
Parental Plasmid:
pcDNA5D-FRT/TO GFP
View Parent Plasmid

|
DU Number:
DU29683
Species:
Mouse
Sequence of Insert:
View Sequence

agatctATGGCCCGTCGCTCCCAGAGCAGCTCGCAGGGGGACAACCCACT GGCACCTGGGTACCTGCCACCTCACTACAAAGAATATTACCGCCTAGCGG TGGATGCATTGACTGAGGGTGGGCCAGAAGCCTACAACCGCTTCTTGGCA TCTGAGGGGGCACCTGACTTCCTGTGCCCTGAGGAACTGGAACACGTGAG CCGCCACCTGCAGCCCCCACAGTATGTGGCCCGGGAACCCCCTGAAGGCA CCCCATCTGATGTGGACATGGACGGGTCCTCAGGCACCTACTGGCCAGTG AACTCAGACCAGGCTGTGCCTGAGCTGGACCTGGGCTGGCCCCTCACATT TGGCTTCCAAGGCACAGAGGTCACCACACTGGTACAGCCGCCGCCACCTG ACAGCCCCAGCATCAAAGATGAAGCTCGGAGGATGATCCGCTCTGCCCAG CAGGTGGTAGCTGTGGTGATGGACATGTTTACCGACGTGGATCTGCTCAG TGAGGTGCTAGAGGCCGCTGCAAGGCGAGTCCCGGTCTACATTCTGCTGG ATGAAATGAACGCCCAGCACTTCCTAGACATGGCCGACAAGTGTCGCGTC AACCTGCATCATGTGGACTTCCTGCGTGTGCGCACAGTGGCAGGTCCTAC TTACTACTGCCGCACTGGGAAGTCTTTCAAGGGCCATCTAAAGGAGAAGT TCTTGCTTGTGGACTGTGCCGTAGTGATGAGCGGCAGTTATAGCTTCATG TGGTCCTTCGAGAAAATCCACCGCAGCCTGGCTCATGTGTTCCAGGGAGA GTTGGTCTCCAGCTTCGACGAAGAGTTCCGCATCCTCTTCGCACAGTCGG AGCCACTGGTGCCCTCAGCCGGGGCGCTAGCCCGCATGGATGCCTATGCG CTAGCTCCATACTCTGGGGCTGGGCCCCTGGTGGGCGTCCCCGGGGTTGG AGCACCAACACCTTTTTCTTTCCCTAAACGGGCGCACCTCCTATTCCCAC CGCCCAGGGAAGAAGGCCTGGGCTTCCCCTCTTTCCTAGACCCTGACCGC CACTTCCTGTCGGCTTTCCGCCGAGAGGAGCTGCAGAGAATGCCTGGGGG TGCTTTGGAGCCTCACACAGGGCTCCGGCCACTGGCGCGCCCAACTGAGG CTGGGCCGTTCGGAGAGCTCGCGGGCCCCCGGGGCTTCTTCCAGTCAAGG CACCTGGAAATGGATGCCTTCAAGCGGCATAGCTACGCAACACCCGATGG AGCTGGAGCAGTGGAGAACTTTGCAGCGGCACGGCAGGTGTCACGACAAA CATTCCTCAGTCACGGTGATGACTTCCGTTTCCAGACCAGCCACTTCCAA CGGGACCAGCTCTATCAGCAGCATTACCAGTGGGACCCACAGTTTGCTCC TGCGCGCCCACAGGGCCTCTTCGAGAAGCTTCGTGCAGGCCGACCTGGCT TTGCGGACCCTGATGACTTTGCCTTAGGTGCTGGTCACCGCTTCCCAGAA CTCGGTGCTGATGTGCACCAACGGCTGGAATACGTGCCATCCAGCGCATC TCGGGAGGTACGCCACGGCTCGGATCCGGCCTTTGGACCCAGCCCCCGTG GTCTAGAGCCCAGTGGAGCCTCGCGTCCCAATCTGGGCCAGCGTTTTCCA TGCCAAGCAACCTTGAGACAAGGCCTGGACACCGCTTCGGAGGCAGAACC TGAGCGCAGGGGCGGACCCGAGGGCCGGGCCGGGCTGCGTCACTGGCGCC TTGCCTCCTACCTGAGCGGCTGCCACGGTGACGGTGGGGAGGAGGGTCTA CCAATGGAGGCTGAGGCTTGTGAAGACGAGGTGCTGGCTCCCGGAGGCCG GGACCTGCTCCCCTCCGCCTTCCGCACTCCTGCAGCCTTCCCAGCTAAGG GACCAAAGCCGGGCTCAGGAAGCGGTGGTGGTGACAGCTCCGAGCGAGAG GGCCCAGAAGAGACAAGCCTGGCTAAGCAGGACTCCTTCCGCTCTCGCTT GAACCCGCTCATCCAGCGCAGCTCCAGGTTGCGCTCATCACTCATCTTTG CGTCCCAGGCTGAGGGTGCTGTTGGGACCGCAGCAGCCACCACTGAAAAA GTACAGCTGATGCACAAAGAACAAACAGTCAGTGAAACTCTGGGTCCCAG CGGAGAGGCTGTTCGTTCCAGCGCCTCGGCCAAAGTGGCGGAGCTCCTGG AGAAATACAAGGGCCCTGCCCGGGACCCTGGCGGTGCAGGAGGTGCCGTC ACTTCCTCCAGCCACAGCAAGGCTGTAGTGTCCCAGGCCTGGCGGGAGGA GGTGGTAGCACCAGGAGGAGCGGGAACTGAACGCCGCAGCCTTGAGAGTT GCTTGCTTGACCTGCGCGATTCCTTTGCCCAGCAGTTGCACCAGGAGGCA GAGCGACACCCAGGAGCCGCTTCGCTCACTGCTGCGCAACTGCTCGACAC CCTGGGCGGCACTGACCGCCTGCCATCACGCTTCCTCTCCGCCCAGGGCC GCTCCTTGTCTCCACAAGGTCGAGATAGCCCTCCGCCAGAAGGGCTTGGG ACACACCAGCTGCCTTATTCTGAGCCAAAGGGAAACCCCACCCCAGCTTA CCCTGAGCGCAAGGGGAGCCCTACCCCAGCTTACCCTGAGCGCAAGGGGA GCCCTACCCCAGCTTACCCTGAGCGCAAGGGGAGCCCTACCCCAGCTTAC CCTGAGCGCAAGGGGAGTCCTACCCAAGCCTACCCTGAGCGCAAGGGGAG CCCCACGTCTGGATTTCCCAATCGGAGGGGCAGCCCAACCACAGGATTGA TGGAGCAGAAGGGAAGTCCCACTTCAACCTACCCAGACCGCAGGGGCAGT CCGGTGCCCCCAGTGCCTGAGCGCAGGGGTAGTCCAGTACCCCCTGTGCC CGAGCGCAGAGGCAGTCTCACTTTCGCTGGGGAGTCTTCGAAGACTGGGC CTACAGAGGAGGTGTCTAGTGGCCCCATGGAAGTCCTGCGAAAGGGTTCT CTCCGCCTCAGGCAGCTGCTGAGCCCCAAGAATGAGAGGCGTGGGGAGGA TGAGGGCAGCTTCCCAACTCCGCAGGAAAATGGGCAGCCCGAGAGCCCCC GGCGGCCCTCGCTGAGTCGGGGTGACAGCACAGAGGCTGCTGCAGAGGAG AGAGGCTCGAGGGTCCGCCTAGCTTCAGCTACAGCCAATGCTCTGTACAG CAGCAATCTGCGAGATGACACTAAGGCCATTCTGGAGCAAATTAGTGCCC ACGGCCAGAAGCACCGCGGGGTCCCTGCTCCAGGTCCAGCCCACAGCAGT CCTGACGTAGGTCGTCCAACAACTGCAGGAGACTTGGCCCCAGACATGTC CGACAAGGACAAATGTTCAGCTATCTTCCGCTCAGACAGCCTAGGGACAC AAGGCCGGCTCAGCCGCACCCTGCCTGGCAGTGCAGAGGAGCGAGACCGG CTCCTTCGCCGCATGGAGAGCATGCGCAAAGAGAAGCGTGTCTACAGTCG CTTCGAAGTCTTCTGCAAAAAGGACGAAGCTGGCAGTAGTGGGGCAGGAG ACAACTTGGCAGATGAGGACACCAGGGACAGTAAAATGGGCAAATTTGTC CCCAAGATCCTGGGCACATTCAAAAGCAAAAAATGAgcggccgc
Amino Acid Sequence:
View Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMARRSQ SSSQGDNPLAPGYLPPHYKEYYRLAVDALTEGGPEAYNRFLASEGAPDFL CPEELEHVSRHLQPPQYVAREPPEGTPSDVDMDGSSGTYWPVNSDQAVPE LDLGWPLTFGFQGTEVTTLVQPPPPDSPSIKDEARRMIRSAQQVVAVVMD MFTDVDLLSEVLEAAARRVPVYILLDEMNAQHFLDMADKCRVNLHHVDFL RVRTVAGPTYYCRTGKSFKGHLKEKFLLVDCAVVMSGSYSFMWSFEKIHR SLAHVFQGELVSSFDEEFRILFAQSEPLVPSAGALARMDAYALAPYSGAG PLVGVPGVGAPTPFSFPKRAHLLFPPPREEGLGFPSFLDPDRHFLSAFRR EELQRMPGGALEPHTGLRPLARPTEAGPFGELAGPRGFFQSRHLEMDAFK RHSYATPDGAGAVENFAAARQVSRQTFLSHGDDFRFQTSHFQRDQLYQQH YQWDPQFAPARPQGLFEKLRAGRPGFADPDDFALGAGHRFPELGADVHQR LEYVPSSASREVRHGSDPAFGPSPRGLEPSGASRPNLGQRFPCQATLRQG LDTASEAEPERRGGPEGRAGLRHWRLASYLSGCHGDGGEEGLPMEAEACE DEVLAPGGRDLLPSAFRTPAAFPAKGPKPGSGSGGGDSSEREGPEETSLA KQDSFRSRLNPLIQRSSRLRSSLIFASQAEGAVGTAAATTEKVQLMHKEQ TVSETLGPSGEAVRSSASAKVAELLEKYKGPARDPGGAGGAVTSSSHSKA VVSQAWREEVVAPGGAGTERRSLESCLLDLRDSFAQQLHQEAERHPGAAS LTAAQLLDTLGGTDRLPSRFLSAQGRSLSPQGRDSPPPEGLGTHQLPYSE PKGNPTPAYPERKGSPTPAYPERKGSPTPAYPERKGSPTPAYPERKGSPT QAYPERKGSPTSGFPNRRGSPTTGLMEQKGSPTSTYPDRRGSPVPPVPER RGSPVPPVPERRGSLTFAGESSKTGPTEEVSSGPMEVLRKGSLRLRQLLS PKNERRGEDEGSFPTPQENGQPESPRRPSLSRGDSTEAAAEERGSRVRLA SATANALYSSNLRDDTKAILEQISAHGQKHRGVPAPGPAHSSPDVGRPTT AGDLAPDMSDKDKCSAIFRSDSLGTQGRLSRTLPGSAEERDRLLRRMESM RKEKRVYSRFEVFCKKDEAGSSGAGDNLADEDTRDSKMGKFVPKILGTFK SKK*
Bacterial Selection:
Amp
Low Growth Temperature Requirement?:
No
Comments:
Parental 41455

Do you need any help? Please get in touch and we’ll be happy to lend a hand.