cDNA Clone - VPS26B

Name: VPS26B
Price per aliquot: £110.00
Expressed:
GFP VPS26B G296-end
Plasmid:
pLVX Hygro GFP VPS26B G296-end
Parent Plasmid:
pLVX Hygro GFP
View Parent Plasmid

|
DU Number:
DU62520
Genbank:
Sequence of Insert:
View Sequence

GGTGACATCGTACGGAAGAGCATGTCCCACCAGGCGGCCATCGCCTCACAGCGCTTTGAGGGCACCACCTCCCTGGGTGAGGTGCGGACCCCCAGCCAGCTGTCTGACAACAACTGCAGGCAGTAGGGATCC
Amino Acid Sequence:
View Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No

Do you need any help? Please get in touch and we’ll be happy to lend a hand.