cDNA Clone - RAB29 (mouse)

Name: RAB29 (mouse)
Price per aliquot: £125.00
Expressed:
6His-SUMO-RAB29 (mouse)
Plasmid:
pet 6His Sumo Rab29 (ms)
Parental Plasmid:
pET 6HIS SUMO
View Parent Plasmid

|
DU Number:
DU59025
Sequence of Insert:
View Sequence

GGATCCATGGGCAGCCGAGATCACCTGTTTAAAGTGCTGGTGGTGGGGGACGCCGCCGTTGGCAAGACGTCTCTGGTCCAGCGCTACTCCCAGGACAGCTTCAGCAAGCACTACAAGTCCACCGTGGGAGTGGATTTTGCTCTCAAGGTTCTCCAGTGGTCTGACTCAGAGATGGTGCGGCTGCAGCTCTGGGATATTGCAGGGCAGGAGCGTTTCACATCCATGACACGACTCTACTATAGAGATGCTTCTGCCTGTGTTATTATGTTTGACGTCACCAATGCCACTACTTTCAGCAACAGCCAAAGATGGAAACAGGATCTGGACAGCAAGCTCACACTACCCAGTGGGGAGCCAGTGCCCTGCCTGCTCTTGGCCAACAAGAGTGATCTGTCCCCTTGGGCAGTGAGCCGGGACCAGATCGACCGGTTCAGTAAAGAGAATGGCTTCACAGGTTGGACAGAAACATCAGTCAAGGAGAACAAAAATATTAATGAGGCCATGAGAGTCCTCGTTGAAAAGATGATGAACAATTCCAGGGAAGATGTGATGTCTTTGTCCACCCAAGGGAACTACATCAATCTCCAAGCCAAGCCCTCCTCTGGCTGGACATGCTGCTAGGCGGCCGC
Amino Acid Sequence:
View Sequence

MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVQMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE QTGGSMGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATT FSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSREDVMSLSTQGNYINLQA KPSSGWTCC*
Bacterial Selection:
Amp
Low Growth Temperature Requirement?:
No
Comments:
SNP Q141R

Do you need any help? Please get in touch and we’ll be happy to lend a hand.